CATH Domain: 2fuiA00 XML data for domain: 2fuiA00

Molscript image for 2fuiA00
2fuiA00
PDB coordinates for domain 2fuiA00

PDB 2fui, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.40 Herpes Virus-1
3.30.40.10 Zinc/RING finger domain, C3HC4 (zinc finger) Gene3D
3.30.40.10.19
3.30.40.10.19.1
3.30.40.10.19.1.1
3.30.40.10.19.1.1.1
3.30.40.10.19.1.1.1.1

[top]
Segment boundaries for domain 2fuiA00

Chopping figure for domain 2fuiA00
DomainStart PDB ResidueStop PDB Residue
2fuiA00 1 62

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2fuiA00
GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2fuiA00
GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 26 Jul 2007 00:26

Assigning to "3.30.40.10" based on similarity with "1wemA00"

Flow stage update by auto on 26 Jul 2007 00:09

No in_process hits for Domain "2fuiA00" ready to be processed

Flow stage update by auto on 26 Jul 2007 00:08

NW result present for Domain "2fuiA00"

Flow stage update by auto on 14 Jul 2007 06:01

All required files are present for Domain "2fuiA00"

Flow stage update by auto on 13 Jul 2007 18:42

Beginning processing for Domain "2fuiA00"

Insertion by auto on 13 Jul 2007 06:14

Final ChopClose added based on similarity with "1wemA"