CATH Domain: 2fq6A02 XML data for domain: 2fq6A02

Molscript image for 2fq6A02
2fq6A02
PDB coordinates for domain 2fq6A02

PDB 2fq6, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.7
3.90.1150.10.7.1
3.90.1150.10.7.1.1
3.90.1150.10.7.1.1.1
3.90.1150.10.7.1.1.1.1

[top]
Segment boundaries for domain 2fq6A02

Chopping figure for domain 2fq6A02
DomainStart PDB ResidueStop PDB Residue
2fq6A01 5 258
2fq6A02 259 395

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ukjA02 88.89 Methionine gamma-lyasePseudomonas putida 3.90.1150.10 134 29 91 2.15 2.34
1b9hA02 77.32 Amycolatopsis mediterraneiRifK 3.90.1150.10 139 9 81 3.91 4.81
1jg8A02 76.42 Thermotoga maritimaThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysL-allo-threonine aldolase 3.90.1150.10 96 19 66 3.01 4.53
1p3wA01 76.36 Thiamine metabolismCysteine desulfurase activitySelenocysteine lyase activityCysteine desulfuraseIron-sulfur cluster assembly 3.90.1150.10 121 9 77 3.69 4.77
3dydA01 76.15 Tyrosine metabolismL-tyrosine:2-oxoglutarate aminotransferase activityMetabolic pathwaysPhenylalanine metabolismUbiquinone and other terpenoid-quinone biosynthesis 3.90.1150.10 137 8 70 3.19 4.55
1eluA01 75.71 Synechocystis sp. PCC 6714L-cysteine/cystine lyase C-DES 3.90.1150.10 115 13 67 2.79 4.11
3k40A03 75.04 Aromatic-L-amino-acid decarboxylase activityDopamine biosynthetic process from tyrosineAromatic-L-amino-acid decarboxylaseDevelopmental pigmentationSerotonin biosynthetic process from tryptophan 3.90.1150.10 99 11 64 2.84 4.37
1iugA01 75.01 Thermus thermophilusAspartate aminotransferase 3.90.1150.10 111 9 67 3.25 4.79
1m32A01 74.55 2-aminoethylphosphonate--pyruvate transaminaseSalmonella enterica subsp. enterica serovar Typhimurium2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]Phosphonate and phosphinate metabolismMetabolic pathways 3.90.1150.10 110 10 68 3.38 4.93
3ftbA01 74.45 Tyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathwaysPhenylalanine metabolism 3.90.1150.10 112 12 68 3.23 4.71
1uu1B01 73.65 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 131 9 61 2.85 4.65
1uu2B01 72.43 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 117 8 61 3.00 4.89
[1]
Displaying entries 1 to 12 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2fq6A02
LGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWKRDFTGSSGLFSFVLKKKLNNEELANYLDNFSLFSMAY
SWGGYESLILANQPEHIAAIRPQGEIDFSGTLIRLHIGLEDVDDLIADLDAGFARIV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2fq6A02
LGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFWKRDFTGSSGLFSFVLKKKLNNEELANYLDNFSLFSMAY
SWGGYESLILANQPEHIAAIRPQGEIDFSGTLIRLHIGLEDVDDLIADLDAGFARIV
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 11 Jan 2007 15:52

Assigning to "3.90.1150.10" based on similarity with "1cl1A02"

Flow stage update by auto on 11 Jan 2007 15:42

No in_process hits for Domain "2fq6A02" ready to be processed

Flow stage update by auto on 11 Jan 2007 15:42

NW result present for Domain "2fq6A02"

Flow stage update by auto on 09 Jan 2007 15:38

All required files are present for Domain "2fq6A02"

Flow stage update by auto on 08 Jan 2007 20:16

Beginning processing for Domain "2fq6A02"

Insertion by auto on 08 Jan 2007 19:44

Final ChopClose added based on similarity with "1cl2A"