CATH Domain: 2fq6A01 XML data for domain: 2fq6A01

Molscript image for 2fq6A01
2fq6A01
PDB coordinates for domain 2fq6A01

PDB 2fq6, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.640 Aspartate Aminotransferase; domain 2
3.40.640.10 Type I PLP-dependent aspartate aminotransferase-like (Major domain) Gene3D
3.40.640.10.11
3.40.640.10.11.1
3.40.640.10.11.1.1
3.40.640.10.11.1.1.1
3.40.640.10.11.1.1.1.1

Segment boundaries for domain 2fq6A01

Chopping figure for domain 2fq6A01
DomainStart PDB ResidueStop PDB Residue
2fq6A01 5 258
2fq6A02 259 395

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.40.640.10.11.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qgnG01 88.69 Cystathionine gamma-synthaseNicotiana tabacum 3.40.640.10 259 24 96 2.00 2.08
1ukjA01 88.04 Methionine gamma-lyasePseudomonas putida 3.40.640.10 254 24 98 1.96 1.99
1bs0A02 82.42 Biotin metabolism8-amino-7-oxononanoate synthaseEscherichia coli K12 3.40.640.10 228 14 82 4.00 4.84
1o4sA02 79.97 Tyrosine metabolismThermotoga maritimaArginine and proline metabolismCysteine metabolismCarbon fixation 3.40.640.10 221 13 76 3.00 3.91
2gsaA02 78.46 Glutamate-1-semialdehyde 2,1-aminomutasePorphyrin and chlorophyll metabolismGlutamate-1-semialdehyde 2,1-aminomutaseSynechococcus elongatus PCC 6301 3.40.640.10 249 8 79 3.73 4.69
1gd9A02 78.45 Tyrosine metabolismArginine and proline metabolismCysteine metabolismPyrococcus horikoshiiCarbon fixation 3.40.640.10 223 12 76 3.02 3.93
1c7nA02 78.02 Treponema denticolaHemolysin 3.40.640.10 225 11 75 2.72 3.62
1fg7A01 77.97 Tyrosine metabolismNovobiocin biosynthesisPhenylalanine, tyrosine and tryptophan biosynthesisHistidine metabolismPhenylalanine metabolism 3.40.640.10 203 13 73 2.60 3.53
1uu1A02 76.99 Histidinol-phosphate aminotransferaseTyrosine metabolismThermotoga maritimaNovobiocin biosynthesisPhenylalanine, tyrosine and tryptophan biosynthesis 3.40.640.10 203 12 75 3.29 4.33
2hoxA02 76.59 Alliin lyase 1 precursorAllium sativum 3.40.640.10 210 12 70 3.16 4.51
1c4kA02 74.99 Lactobacillus sp. 30AOrnithine decarboxylase, inducible 3.40.640.10 313 7 67 3.24 4.81
Displaying entries 1 to 11 (page 1 of 1)


Domain ATOM Sequence

>pdb|2fq6A01
KLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHATRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFP
CGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFLESPGSITMEVH
DVPAIVAAVRSVVPDAIIMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVCNARCWEQLRENAYLMGQMV
DADTAYITSRGLRT    

Domain COMBS Sequence

>pdb|2fq6A01
KLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHATRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFP
CGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFLESPGSITMEVH
DVPAIVAAVRSVVPDAIIMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVCNARCWEQLRENAYLMGQMV
DADTAYITSRGLRT    

Domain History Events (6)

Domain assigned by auto on 24 May 2007 02:09

Assigning to "3.40.640.10" based on similarity with "1cl2A01"

Flow stage update by auto on 14 Mar 2007 15:15

No in_process hits for Domain "2fq6A01" ready to be processed

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "2fq6A01"

Flow stage update by auto on 14 Mar 2007 15:05

All required files are present for Domain "2fq6A01"

Flow stage update by auto on 14 Mar 2007 15:00

Beginning processing for Domain "2fq6A01"

Insertion by auto on 08 Jan 2007 19:44

Final ChopClose added based on similarity with "1cl2A"