Domain assigned by auto on 28 Apr 2006 22:05
Assigning to "3.30.470.20" based on similarity with "1eucB01" (NWSI: 99.3548387096774, NWO: 99.3589743589744, SPS: 96.45, SPO: 100, RMSD: 0.66)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2fp4B01 | 1 | 20 |
| 2fp4B01 | 112 | 246 |
| 2fp4B02 | 21 | 111 |
| 2fp4B03 | 247 | 392 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|2fp4B01 MNLQEYQSKKLMSDNGVKVQSRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMA ENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENE
Assigning to "3.30.470.20" based on similarity with "1eucB01" (NWSI: 99.3548387096774, NWO: 99.3589743589744, SPS: 96.45, SPO: 100, RMSD: 0.66)
NW result present for Domain "2fp4B01"
All required files are present for Domain "2fp4B01"
Beginning processing for Domain "2fp4B01"