CATH Domain: 2fnaA02 XML data for domain: 2fnaA02

Molscript image for 2fnaA02
2fnaA02
PDB coordinates for domain 2fnaA02

PDB 2fna, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.8 Helicase, Ruva Protein; domain 3
1.10.8.60 Gene3D
1.10.8.60.5
1.10.8.60.5.1
1.10.8.60.5.1.1
1.10.8.60.5.1.1.1
1.10.8.60.5.1.1.1.1

Segment boundaries for domain 2fnaA02

Chopping figure for domain 2fnaA02
DomainStart PDB ResidueStop PDB Residue
2fnaA01 0 207
2fnaA02 208 283
2fnaA03 284 356

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 1.10.8.60.5.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2chgA02 83.30 Archaeoglobus fulgidusReplication factor C small subunitReplication factor C small subunit 1.10.8.60 66 9 77 2.08 2.70
1sxjC02 82.40 Nucleotide excision repairDNA replicationLeading strand elongationReplication factor C subunit 3Replication factor C subunit 3/5 1.10.8.60 69 5 78 2.52 3.22
1jr3D03 82.34 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 1.10.8.60 71 5 78 2.52 3.22
1sxjE02 81.27 Leading strand elongationNucleotide excision repairDNA replicationReplication factor C subunit 3/5Sister chromatid cohesion 1.10.8.60 64 9 72 2.12 2.91
3bosA02 81.03 DnaA-homolog proteinShewanella amazonensis SB2BRegulatory inactivation of DnaA Hda protein 1.10.8.60 59 6 68 2.23 3.24
2z4sA02 80.00 Thermotoga maritimaTwo-component systemChromosomal replication initiator proteinChromosomal replication initiator protein dnaA 1.10.8.60 72 9 81 3.93 4.85
1njgA02 79.77 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 1.10.8.60 66 6 79 3.61 4.53
1nvmA02 79.17 Pseudomonas sp. CF6004-hydroxy-2-oxovalerate aldolase 1.10.8.60 64 6 75 3.75 4.96
1e32A04 78.85 Mus musculusPolyubiquitin bindingProtein complexAggresome assemblyTransitional endoplasmic reticulum ATPase 1.10.8.60 87 10 67 3.05 4.50
1sxjD02 78.26 DNA replicationNucleotide excision repairLeading strand elongationCell cycle checkpointProtein binding 1.10.8.60 70 11 74 2.76 3.71
1r7rA06 78.04 Mus musculusPolyubiquitin bindingProtein complexAggresome assemblyTransitional endoplasmic reticulum ATPase 1.10.8.60 58 1 72 3.27 4.48
1fnnA01 78.02 Pyrobaculum aerophilumCell division control protein 6 (Cdc6), putativeArchaeal cell division control protein 6 1.10.8.60 101 4 57 2.22 3.87
1njgB01 76.24 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 1.10.8.60 73 8 77 3.62 4.70
3bg5B07 72.04 Citrate cycle (TCA cycle)Pyruvate metabolismMetabolic pathwaysPyruvate carboxylase subunit A [EC:6.4.1.1]Pyruvate carboxylase subunit B [EC:6.4.1.1] 1.10.10.60 46 10 55 2.62 4.73
3bg3B04 71.18 Pyruvate carboxylase subunit A [EC:6.4.1.1]Citrate cycle (TCA cycle)Biotin bindingPyruvate metabolismPyruvate carboxylase, mitochondrial 1.10.10.60 44 6 58 2.78 4.78
Displaying entries 1 to 15 (page 1 of 1)


Domain ATOM Sequence

>pdb|2fnaA02
FSREEAIEFLRRGFQEADIDFKDYEVVYEKIGGIPGWLTYFGFIYLDNKNLDFAINQTLEYAKKLILKEFENFLHG    

Domain COMBS Sequence

>pdb|2fnaA02
FSREEAIEFLRRGFQEADIDFKDYEVVYEKIGGIPGWLTYFGFIYLDNKNLDFAINQTLEYAKKLILKEFENFLHG    

Domain History Events (12)

Domain assigned by auto on 07 Feb 2008 14:22

Assigning to "1.10.8.60" based on similarity with "2fnaB02"

Flow stage update by auto on 07 Feb 2008 14:07

No in_process hits for Domain "2fnaA02" ready to be processed

Update comment by auto on 03 Sep 2007 20:09

Domain "2fnaA02" hits Domain "2fnaB02" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:15

Domain "2fnaA02" hits Domain "2fnaB02" (100% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:41

Domain "2fnaA02" hits Domain "2fnaB02" (100% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:24

Domain "2fnaA02" hits Domain "2fnaB02" (100% over 100%) which is currently in process

Update comment by auto on 06 Jul 2007 04:56

Domain "2fnaA02" hits Domain "2fnaB02" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Jul 2007 04:54

Domain "2fnaA02" hits Domain "2fnaB02" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Jul 2007 04:54

NW result present for Domain "2fnaA02"

Flow stage update by auto on 04 Jul 2007 22:02

All required files are present for Domain "2fnaA02"

Flow stage update by auto on 04 Jul 2007 12:48

Beginning processing for Domain "2fnaA02"

Insertion by auto on 04 Jul 2007 12:24

Final ChopClose added based on similarity with "2fnaB"