CATH Domain: 2fmpA02 XML data for domain: 2fmpA02

Molscript image for 2fmpA02
2fmpA02
PDB coordinates for domain 2fmpA02

PDB 2fmp, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.20 5' to 3' exonuclease, C-terminal subdomain Gene3D
1.10.150.20.9
1.10.150.20.9.1
1.10.150.20.9.1.1
1.10.150.20.9.1.1.1
1.10.150.20.9.1.1.1.1

[top]
Segment boundaries for domain 2fmpA02

Chopping figure for domain 2fmpA02
DomainStart PDB ResidueStop PDB Residue
2fmpA01 10 91
2fmpA02 92 148
2fmpA03 149 271
2fmpA04 272 335

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 1.10.150.20.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2bcqA02 94.33 Nucleotide-excision repairNon-homologous end-joiningBase excision repairDNA polymerase lambdaDNA polymerase lambda subunit [EC:2.7.7.7 4.2.99.-] 1.10.150.20 54 29 94 1.15 1.21
2i1qA01 84.22 DNA repair and recombination protein radAMethanococcus voltae 1.10.150.20 62 22 79 3.87 4.90
1y88A02 84.15 Archaeoglobus fulgidusUncharacterized protein AF_1548 1.10.150.20 59 14 83 2.64 3.18
2q0zX02 84.12 ATP-dependent helicase activityPre-mRNA-splicing helicase BRR2 [EC:3.6.1.-]Protein bindingU5 small nuclear ribonucleoprotein 200 kDa helicaseU5 snRNP 1.10.150.20 56 8 82 2.90 3.52
1wcnA01 82.59 N utilization substance protein ATranscription elongation protein nusAEscherichia coli K-12 1.10.150.20 60 19 81 2.54 3.11
1dgsA05 81.15 DNA ligaseThermus filiformis 1.10.150.20 69 12 75 2.33 3.09
1dxsA00 80.97 DNA damage response, signal transduction resulting in induction of apoptosisTranscription factor bindingProtein bindingPositive regulation of transcription, DNA-dependentMismatch repair 1.10.150.50 57 17 82 3.22 3.91
1x9xA00 79.90 MAPK signaling pathway - yeastSAM domain bindingIdentical protein bindingInvasive growth in response to glucose limitationActivation of MAPKK activity 1.10.150.50 62 10 79 3.38 4.28
1oaiA00 79.58 Nuclear RNA export factor 1Homo sapiensProtein binding 1.10.8.10 59 5 81 3.88 4.77
1z1vA00 79.11 Protein kinase regulator activitySAM domain bindingProtein STE50Signal transduction involved in filamentous growthPheromone-dependent signal transduction involved in conjugation with cellular fusion 1.10.150.50 70 8 77 3.16 4.10
1bvsA02 79.01 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAMycobacterium lepraeHolliday junction DNA helicase RuvA 1.10.150.20 70 15 81 3.89 4.78
2dflA01 78.29 DNA repair and recombination protein radASulfolobus solfataricusDNA repair protein RadA 1.10.150.20 60 15 83 3.62 4.34
1a5tA02 77.45 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 1.10.8.10 40 7 66 2.65 3.98
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2fmpA02
DTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2fmpA02
DTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEK
BLAST against CATH

[top]
Domain History Events (5)

Flow stage update by auto on 02 Dec 2006 17:18

No in_process hits for Domain "2fmpA02" ready to be processed

Flow stage update by auto on 02 Dec 2006 17:18

NW result present for Domain "2fmpA02"

Flow stage update by auto on 29 Nov 2006 13:24

All required files are present for Domain "2fmpA02"

Flow stage update by auto on 28 Nov 2006 21:32

Beginning processing for Domain "2fmpA02"

Insertion by auto on 28 Nov 2006 21:28

Final ChopClose added based on similarity with "1mq2A"