CATH Domain: 2fb9A02 XML data for domain: 2fb9A02

Molscript image for 2fb9A02
2fb9A02
PDB coordinates for domain 2fb9A02

PDB 2fb9, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.470 D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.20 ATP-grasp fold, B domain Gene3D
3.30.470.20.6
3.30.470.20.6.1
3.30.470.20.6.1.1
3.30.470.20.6.1.1.1
3.30.470.20.6.1.1.1.1

[top]
Segment boundaries for domain 2fb9A02

Chopping figure for domain 2fb9A02
DomainStart PDB ResidueStop PDB Residue
2fb9A01 1 107
2fb9A02 108 132
2fb9A02 196 322
2fb9A03 135 191

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.470.20.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2pn1A03 76.35 Pyrimidine metabolismExiguobacterium sibiricum 255-15Alanine, aspartate and glutamate metabolismCarbamoyl-phosphate synthase large subunit [EC:6.3.5.5]Metabolic pathways 3.30.470.20 116 18 63 2.69 4.22
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2fb9A02
AGVAASALCMDKDLSKRVLAQAGVPSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQ
ETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2fb9A02
AGVAASALCMDKDLSKRVLAQAGVPSPVRELEVGVLGNVFGEASPVGEVRYEAPFYDYETKYTPGRAELLIPAPLDPGTQ
ETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAGGVAYPELLRRLVELALT
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 25 Jul 2007 14:58

Assigning to "3.30.470.20" based on similarity with "1e4eA01"

Flow stage update by auto on 25 Jul 2007 14:55

No in_process hits for Domain "2fb9A02" ready to be processed

Flow stage update by auto on 25 Jul 2007 14:55

NW result present for Domain "2fb9A02"

Flow stage update by auto on 14 Jul 2007 06:01

All required files are present for Domain "2fb9A02"

Flow stage update by auto on 13 Jul 2007 18:42

Beginning processing for Domain "2fb9A02"

Insertion by auto on 13 Jul 2007 05:07

Final ChopClose added based on similarity with "1e4eA"