CATH Domain: 2fa1A00 XML data for domain: 2fa1A00

Molscript image for 2fa1A00
2fa1A00
PDB coordinates for domain 2fa1A00

PDB 2fa1, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1410 Chorismate lyase
3.40.1410.10 Chorismate lyase Gene3D
3.40.1410.10.3
3.40.1410.10.3.1
3.40.1410.10.3.1.1
3.40.1410.10.3.1.1.1
3.40.1410.10.3.1.1.1.1

[top]
Segment boundaries for domain 2fa1A00

Chopping figure for domain 2fa1A00
DomainStart PDB ResidueStop PDB Residue
2fa1A00 83 241

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.40.1410.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bwgC02 85.97 GntR family transcriptional regulator, transcriptional regulator of bglABacillus subtilisUncharacterized HTH-type transcriptional regulator yydK 3.40.1410.10 155 19 95 3.10 3.24
3cnvA01 84.87 GntR family transcriptional regulatorBordetella bronchisepticaPutative GntR-family transcriptional regulator 3.40.1410.10 150 16 89 2.85 3.19
3ddvB01 84.68 GntR family transcriptional regulatorTranscriptional regulator, GntR familyEnterococcus faecalis 3.40.1410.10 137 17 86 2.44 2.83
3eetB02 83.80 Streptomyces avermitilisPutative GntR-family transcriptional regulator 3.40.1410.10 161 15 89 2.79 3.12
2p19A01 83.53 Corynebacterium glutamicumBacterial regulatory proteins, gntR family 3.40.1410.10 130 27 81 2.63 3.22
2pkhB01 83.41 Pseudomonas syringae pv. tomatoHistidine utilization repressorGntR family transcriptional regulator, histidine utilization repressor 3.40.1410.10 129 19 80 2.73 3.39
2nwiB00 81.56 Archaeoglobus fulgidusPutative uncharacterized protein 3.40.1410.10 151 15 86 3.52 4.06
2oggA01 81.55 GntR family transcriptional regulator, trehalose operon transcriptional repressorBacillus subtilisTrehalose operon transcriptional repressor 3.40.1410.10 133 16 83 2.74 3.28
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2fa1A00
HMNAQARFSQNLLDQGSHPTSEKLLSVLRPASGHVADALGITEGENVIHLRTLRRVNGVALCLIDHYFADLTLWPTLQRF
DSGSLHDFLREQTGIALRRSQTRISARRAQAKECQRLEIPNMSPLLCVRTLNHRDGESSPAEYSVSLTRADMIEFTMEH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2fa1A00
GHMNAQARFSQNLLDQGSHPTSEKLLSVLRPASGHVADALGITEGENVIHLRTLRRVNGVALCLIDHYFADLTLWPTLQR
FDSGSLHDFLREQTGIALRRSQTRISARRAQAKECQRLEIPNMSPLLCVRTLNHRDGESSPAEYSVSLTRADMIEFTMEH
BLAST against CATH

[top]
Domain History Events (86)

Domain assigned by cuff on 12 Nov 2007 16:59

similar in structure and function. scop suggests same superfamily

Domain assignment manual match h by tronnberg on 29 Oct 2007 14:30

Same superfamily

Homcheck review by tronnberg on 29 Oct 2007 14:30

Same superfamily

Flow stage update by tronnberg on 29 Oct 2007 14:30

Same superfamily

Homcheck return by cuff on 29 Oct 2007 13:58

have another look. This isnt just a architecture match. Pre scop and scop suggests that the match and query belong to the same superfamily

Flow stage update by cuff on 29 Oct 2007 13:58

have another look. This isnt just a architecture match. Pre scop and scop suggests that the match and query belong to the same superfamily

Domain scan prc pfamcath by auto on 25 Sep 2007 11:42

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3 results for 2fa1A00

Domain assignment manual match a by tronnberg on 04 Sep 2007 15:46

SSAP: 78.46 OV: 81 SEQ: 11. Some similar linkages. The query and match do differ with a few secondary structures. I believe that 2ikkB00 (TBA) should be aasign to the same topology as the query.

Homcheck review by tronnberg on 04 Sep 2007 15:46

SSAP: 78.46 OV: 81 SEQ: 11. Some similar linkages. The query and match do differ with a few secondary structures. I believe that 2ikkB00 (TBA) should be aasign to the same topology as the query.

Flow stage update by tronnberg on 04 Sep 2007 15:46

SSAP: 78.46 OV: 81 SEQ: 11. Some similar linkages. The query and match do differ with a few secondary structures. I believe that 2ikkB00 (TBA) should be aasign to the same topology as the query.

Domain assignment manual match t by tronnberg on 20 Aug 2007 15:36

Good SSAP score of 86, seq similarity = 17. Function for match is unknown.

Homcheck allotment by tronnberg on 20 Aug 2007 15:32

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Aug 2007 15:32

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 18 Jul 2007 04:47

Domain "2fa1A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 18 Jul 2007 04:47

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2fa1A00

Flow stage update by auto on 18 Jul 2007 04:10

Retrieved PRC_PFAMCATH results for job ID SID0739802251304768 and chopping inserted.

Update comment by auto on 17 Jul 2007 08:25

PRC_PFAMCATH job SID0739802251304768 is not yet finished.

Prc pfamcath submit by auto on 17 Jul 2007 08:19

The entry "2fa1A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Jul 2007 08:19

The entry "2fa1A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Jul 2007 07:47

Retrieved SSAP results for job ID SID3494768499611456 and chopping inserted.

Domain scan ssap cath by auto on 17 Jul 2007 07:45

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 868 results for 2fa1A00

Update comment by auto on 16 Jul 2007 11:23

SSAP job SID3494768499611456 is not yet finished.

Flow stage update by auto on 16 Jul 2007 11:11

The entry "2fa1A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Jul 2007 11:11

The entry "2fa1A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Jul 2007 06:56

Unable to retrieve "2fa1A00" SSAP results for job "SID4763056796122576"

Update comment by auto on 14 Jul 2007 13:36

SSAP job SID4763056796122576 is not yet finished.

Ssap cath submit by auto on 14 Jul 2007 13:18

The entry "2fa1A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Jul 2007 13:18

The entry "2fa1A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Jul 2007 07:17

Giving up on SSAP job SID6953561255513960 because submission time of Wed Jul 11 22:28:31 2007 is more than 172800 seconds older than current time (Sat Jul 14 07:18:00 2007).

Update comment by auto on 11 Jul 2007 22:48

SSAP job SID6953561255513960 is not yet finished.

Flow stage update by auto on 11 Jul 2007 22:28

The entry "2fa1A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 11 Jul 2007 22:28

The entry "2fa1A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 11 Jul 2007 21:01

Giving up on SSAP job SID5880786097987412 because submission time of Mon Jul 9 19:55:20 2007 is more than 172800 seconds older than current time (Wed Jul 11 21:01:46 2007).

Update comment by auto on 09 Jul 2007 20:31

SSAP job SID5880786097987412 is not yet finished.

Ssap cath submit by auto on 09 Jul 2007 19:55

The entry "2fa1A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Jul 2007 19:55

The entry "2fa1A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Jul 2007 15:45

Giving up on SSAP job SID1566524634624080 because submission time of Sat Jul 7 14:43:27 2007 is more than 172800 seconds older than current time (Mon Jul 9 15:45:07 2007).

Update comment by auto on 07 Jul 2007 15:20

SSAP job SID1566524634624080 is not yet finished.

Ssap cath submit by auto on 07 Jul 2007 14:43

The entry "2fa1A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 07 Jul 2007 14:43

The entry "2fa1A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 07 Jul 2007 12:53

Giving up on SSAP job SID8191149353941328 because submission time of Thu Jul 5 11:40:25 2007 is more than 172800 seconds older than current time (Sat Jul 7 12:53:14 2007).

Update comment by auto on 05 Jul 2007 12:37

SSAP job SID8191149353941328 is not yet finished.

Flow stage update by auto on 05 Jul 2007 11:40

The entry "2fa1A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Jul 2007 11:40

The entry "2fa1A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Jul 2007 10:12

Retrieved PRC results for job ID SID4688997121653920 and inserted them into the database.

Domain scan prc cath by auto on 05 Jul 2007 10:12

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 2fa1A00

Update comment by auto on 04 Jul 2007 12:10

PRC job SID4688997121653920 is not yet finished.

Prc cath submit by auto on 04 Jul 2007 11:22

The entry "2fa1A00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Jul 2007 11:22

The entry "2fa1A00" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Jul 2007 10:53

Retrieved HMM(SAM) results for job ID SID5609685453207552 and inserted them into the database.

Domain scan sam cath by auto on 04 Jul 2007 10:52

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2fa1A00

Update comment by auto on 04 Jul 2007 00:42

HMM(SAM) job SID5609685453207552 is not yet finished.

Sam cath submit by auto on 03 Jul 2007 22:58

The entry "2fa1A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Jul 2007 22:58

The entry "2fa1A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Jul 2007 21:41

Retrieved "2fa1A00" CATHEDRAL results for job ID SID8323913861160816 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Jul 2007 21:41

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 118 results for 2fa1A00

Update comment by auto on 03 Jul 2007 09:17

"2fa1A00" CATHEDRAL job SID8323913861160816 is not yet finished.

Cathedral cath submit by auto on 03 Jul 2007 08:02

The entry "2fa1A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Jul 2007 08:02

The entry "2fa1A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Jul 2007 07:04

ScanList with 8825 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2fa1A00.scanlist" for "2fa1A00"

Write scan list by auto on 03 Jul 2007 07:03

Writing ScanList containing 8825 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2fa1A00.scanlist" for domain "2fa1A00"

Update comment by auto on 03 Jul 2007 02:13

Waiting for 19 new domains (example : 2obkD00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jul 2007 22:06

Waiting for 75 new domains (example : 2hh9B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jul 2007 18:22

Waiting for 150 new domains (example : 2a7wF00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 10:03

Waiting for 155 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 06:06

Waiting for 154 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 02:06

Waiting for 153 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 22:02

Waiting for 151 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 18:09

Waiting for 149 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 14:08

Waiting for 147 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 10:04

Waiting for 145 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 06:03

Waiting for 142 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 02:07

Waiting for 139 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 22:02

Waiting for 136 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 18:11

Waiting for 133 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 14:07

Waiting for 130 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 10:04

Waiting for 126 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 06:08

Waiting for 120 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 02:09

Waiting for 114 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jun 2007 22:29

Waiting for 100 new domains (example : 2a7wC00) to be processed so that they can be scanned against too.

Flow stage update by auto on 27 Jun 2007 22:19

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Mar 2007 15:15

No in_process hits for Domain "2fa1A00" ready to be processed

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "2fa1A00"

Flow stage update by auto on 14 Mar 2007 15:05

All required files are present for Domain "2fa1A00"

Flow stage update by auto on 14 Mar 2007 15:00

Beginning processing for Domain "2fa1A00"

Insertion by auto on 13 Dec 2006 19:28

Final ChopClose added based on similarity with "2fa1B"