CATH Domain: 2f4lA02 XML data for domain: 2f4lA02

Molscript image for 2f4lA02
2f4lA02
PDB coordinates for domain 2f4lA02

PDB 2f4l, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.10 Thrombin, subunit H
2.40.10.120 Gene3D
2.40.10.120.3
2.40.10.120.3.1
2.40.10.120.3.1.1
2.40.10.120.3.1.1.1
2.40.10.120.3.1.1.1.1

Segment boundaries for domain 2f4lA02

Chopping figure for domain 2f4lA02
DomainStart PDB ResidueStop PDB Residue
2f4lA01 2 76
2f4lA01 120 203
2f4lA02 77 119
2f4lA03 204 283

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|2f4lA02
PRRGIVTGKGFGVLGDEVEGFHTKELEIEKWAVLFDGVRIPI    

Domain COMBS Sequence

>pdb|2f4lA02
PRRGXIVTGKGFGVLGDEVEGFHTKELEIEKWAVLFDGVRIPI    

Domain History Events (80)

Domain assigned by cuff on 10 Mar 2008 09:58

same superfamily

Domain assignment manual match h by cuff on 10 Mar 2008 09:56

same superfamily

Domain assignment manual match t by tronnberg on 29 Oct 2007 14:20

I am not sure, but the match has similar linkage..

Homcheck review by tronnberg on 29 Oct 2007 14:20

I am not sure, but the match has similar linkage..

Flow stage update by tronnberg on 29 Oct 2007 14:20

I am not sure, but the match has similar linkage..

Homcheck return by cuff on 29 Oct 2007 12:37

I think there is a fold level, not just an architecture level match here - but I dont think its in the architecture 2.20. Have another look

Flow stage update by cuff on 29 Oct 2007 12:37

I think there is a fold level, not just an architecture level match here - but I dont think its in the architecture 2.20. Have another look

Domain assignment manual match a by tronnberg on 07 Sep 2007 10:37

SSAP: 72.21 OV: 47 SEQ: 7. Some similarity between the linkage and structure. Function for query is unknown.

Homcheck review by tronnberg on 07 Sep 2007 10:37

SSAP: 72.21 OV: 47 SEQ: 7. Some similarity between the linkage and structure. Function for query is unknown.

Flow stage update by tronnberg on 07 Sep 2007 10:37

SSAP: 72.21 OV: 47 SEQ: 7. Some similarity between the linkage and structure. Function for query is unknown.

Homcheck allotment by tronnberg on 07 Sep 2007 10:31

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 07 Sep 2007 10:31

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 02:19

Domain "2f4lA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 02:18

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2f4lA02

Flow stage update by auto on 07 Sep 2007 00:02

Retrieved PRC_PFAMCATH results for job ID SID5126423967065376 and results inserted.

Domain scan prc pfamcath by auto on 07 Sep 2007 00:00

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3 results for 2f4lA02

Update comment by auto on 05 Sep 2007 22:21

PRC_PFAMCATH job SID5126423967065376 is not yet finished.

Flow stage update by auto on 05 Sep 2007 22:15

The entry "2f4lA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 05 Sep 2007 22:15

The entry "2f4lA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Sep 2007 19:12

Retrieved SSAP results for job ID SID8323796383871680 and results inserted.

Domain scan ssap cath by auto on 05 Sep 2007 19:10

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 450 results for 2f4lA02

Ssap cath submit by auto on 05 Sep 2007 15:37

The entry "2f4lA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 15:37

The entry "2f4lA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 05:06

Retrieved PRC results for job ID SID2909559965413184 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 05:05

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2f4lA02

Prc cath submit by auto on 04 Sep 2007 13:40

The entry "2f4lA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 13:40

The entry "2f4lA02" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 11:03

Retrieved HMM(SAM) results for job ID SID0455235693113184 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 11:02

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2f4lA02

Sam cath submit by auto on 04 Sep 2007 09:27

The entry "2f4lA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:27

The entry "2f4lA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 20:43

Retrieved "2f4lA02" CATHEDRAL results for job ID SID7541884921129984 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 20:42

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 228 results for 2f4lA02

Cathedral cath submit by auto on 03 Sep 2007 13:36

The entry "2f4lA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:36

The entry "2f4lA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:28

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2f4lA02.scanlist" for "2f4lA02"

Write scan list by auto on 03 Sep 2007 11:28

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2f4lA02.scanlist" for domain "2f4lA02"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:19

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:20

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:13

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:25

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:10

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:12

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:13

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:39

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:12

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:29

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:04

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:14

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:10

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:30

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:34

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:14

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:41

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:03

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:21

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:27

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:31

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:48

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:12

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 08:10

Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 02:18

Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 22:19

Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 18:12

Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 14:12

Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 10:24

Waiting for 1921 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 06:30

Waiting for 1975 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 02:23

Waiting for 2046 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 22:18

Waiting for 2103 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 18:24

Waiting for 2173 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 26 Aug 2007 18:23

No satisfactory AssignClose result found.

Flow stage update by auto on 26 Aug 2007 18:09

No in_process hits for Domain "2f4lA02" ready to be processed

Flow stage update by auto on 26 Aug 2007 18:09

NW result present for Domain "2f4lA02"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2f4lA02"

Flow stage update by auto on 18 Aug 2007 14:31

Beginning processing for Domain "2f4lA02"

Insertion by cuff on 18 Aug 2007 12:35

nice chopping