CATH Domain: 2f48A03 XML data for domain: 2f48A03

Molscript image for 2f48A03
2f48A03
PDB coordinates for domain 2f48A03

PDB 2f48, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.10 Arc Repressor Mutant, subunit A
1.10.10.480 Phosphofructokinase; domain 3 Gene3D
1.10.10.480.1
1.10.10.480.1.1
1.10.10.480.1.1.1
1.10.10.480.1.1.1.1
1.10.10.480.1.1.1.1.1

Segment boundaries for domain 2f48A03

Chopping figure for domain 2f48A03
DomainStart PDB ResidueStop PDB Residue
2f48A01 5 219
2f48A01 432 501
2f48A02 220 317
2f48A02 393 431
2f48A02 502 552
2f48A03 318 392

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.10.10.480.1.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nklA00 79.14 Sus scrofaAntimicrobial peptide NK-lysin 1.10.225.10 78 9 88 3.90 4.41
2gtgA00 78.11 Proactivator polypeptideLipid transportGlycosphingolipid metabolic processEnzyme activator activityIntegral to membrane 1.10.225.10 78 8 83 3.91 4.69
1l9lA00 77.55 GranulysinHomo sapiensCellular defense responseExtracellular space 1.10.225.10 74 8 89 4.30 4.81
Displaying entries 1 to 3 (page 1 of 1)


Domain ATOM Sequence

>pdb|2f48A03
IPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRV    

Domain COMBS Sequence

>pdb|2f48A03
IPEVKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGNFNVSRV    

Domain History Events (11)

Domain assigned by auto on 11 Mar 2009 21:12

Assigning to "1.10.10.480" based on similarity with "1kzhA03"

Flow stage update by auto on 11 Mar 2009 21:08

No in_process hits for Domain "2f48A03" ready to be processed

Update comment by auto on 23 Jul 2008 18:25

Domain "2f48A03" hits Domain "1kzhB03" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:17

Domain "2f48A03" hits Domain "1kzhB03" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:24

Domain "2f48A03" hits Domain "1kzhB03" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:49

Domain "2f48A03" hits Domain "1kzhB03" (100% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:15

Domain "2f48A03" hits Domain "1kzhB03" (100% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "2f48A03"

Flow stage update by auto on 14 Mar 2007 15:05

All required files are present for Domain "2f48A03"

Flow stage update by auto on 14 Mar 2007 15:00

Beginning processing for Domain "2f48A03"

Insertion by auto on 08 Jan 2007 19:29

Final ChopClose added based on similarity with "1kzhA"