Domain assigned by auto on 13 Nov 2007 18:15
Assigning to "3.90.190.10" based on similarity with "2f46B00"
There are 12 matching structural neighberhood comparisons for CATH ID 3.90.190.10.14.1.1.1.1 (SIMAX score < 5)
>pdb|2f46A00 KAILKLDEHLYISPQLTKADAEQIAQLGIKTIICNRPDREEESQPDFAQIKQWLEQAGVTGFHHQPVTARDIQKHDVETF RQLIGQAEYPVLAYCRTGTRCSLLWGFRRAAEGPVDEIIRRAQAAGVNLENFRERLDNARV
Assigning to "3.90.190.10" based on similarity with "2f46B00"
No in_process hits for Domain "2f46A00" ready to be processed
Domain "2f46A00" hits Domain "2f46B00" (98.0769230769231% over 100%) which is currently in process
Domain "2f46A00" hits Domain "2f46B00" (98.0769230769231% over 100%) which is currently in process
Domain "2f46A00" hits Domain "2f46B00" (98.0769230769231% over 100%) which is currently in process
Domain "2f46A00" hits Domain "2f46B00" (98.0769230769231% over 100%) which is currently in process
NW result present for Domain "2f46A00"
All required files are present for Domain "2f46A00"
Beginning processing for Domain "2f46A00"
Final ChopClose added based on similarity with "2f46B"