CATH Domain: 2f2gA00 XML data for domain: 2f2gA00

Molscript image for 2f2gA00
2f2gA00
PDB coordinates for domain 2f2gA00

PDB 2f2g, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.910 Heme Oxygenase; Chain A
1.20.910.10 Heme Oxygenase; Chain A Gene3D
1.20.910.10.11
1.20.910.10.11.1
1.20.910.10.11.1.1
1.20.910.10.11.1.1.1
1.20.910.10.11.1.1.1.1

[top]
Segment boundaries for domain 2f2gA00

Chopping figure for domain 2f2gA00
DomainStart PDB ResidueStop PDB Residue
2f2gA00 5 219

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.20.910.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rtwB00 87.55 Pyrococcus furiosusTranscriptional activator, putative 1.20.910.10 204 19 91 2.05 2.23
2qcxA00 85.57 Thiamine metabolismBacillus subtilisThiaminase-2Transcriptional activator TenA [EC:3.5.99.2] 1.20.910.10 222 12 90 2.52 2.78
1uddA00 84.19 Thiamine metabolismPyrococcus horikoshiiTranscriptional activator TenA [EC:3.5.99.2]218aa long hypothetical transcriptional regulator 1.20.910.10 215 13 92 2.59 2.81
1rcwB00 80.16 Chlamydia trachomatisPqqC-like proteinPyrroloquinoline-quinone synthase [EC:1.3.3.11] 1.20.910.10 210 9 94 3.77 3.98
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2f2gA00
GVIDTWIDKHRSIYTAATRHAFVVSIRDGSVDLSSFRTWLGQDYLFVRRFVPFVASVLIRACKDSGESSDEVVLGGIASL
NDEIEWFKREGSKWDVDFSTVVPQRANQEYGRFLEDLSSEVKYPVITAFWAIEAVYQESFAHCLEDGNKTPVELTGACHR
WGNDGFKQYCSSVKNIAERCLENASGEVLGEAEDVLVRVLELEVAFWESRG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2f2gA00
XEKRGVIDTWIDKHRSIYTAATRHAFVVSIRDGSVDLSSFRTWLGQDYLFVRRFVPFVASVLIRACKDSGESSDXEVVLG
GIASLNDEIEWFKREGSKWDVDFSTVVPQRANQEYGRFLEDLXSSEVKYPVIXTAFWAIEAVYQESFAHCLEDGNKTPVE
LTGACHRWGNDGFKQYCSSVKNIAERCLENASGEVLGEAEDVLVRVLELEVAFWEXSRGGQ
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:58

Assigning to "1.20.910.10" based on similarity with "1q4mA00" (NWSI: 97.737556561086, NWO: 100, SPS: 99.06, SPO: 100, RMSD: 0.11)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "2f2gA00"

Flow stage update by auto on 28 Apr 2006 17:49

All required files are present for Domain "2f2gA00"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "2f2gA00"

Insertion by auto on 10 Mar 2006 20:48

Final ChopClose added based on similarity with "1q4mA" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 99.06, SI: 97.737556561086, SO: 100]