CATH Domain: 2essA01 XML data for domain: 2essA01

Molscript image for 2essA01
2essA01
PDB coordinates for domain 2essA01

PDB 2ess, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.129 Thiol Ester Dehydrase; Chain A
3.10.129.10 Gene3D
3.10.129.10.14
3.10.129.10.14.1
3.10.129.10.14.1.1
3.10.129.10.14.1.1.1
3.10.129.10.14.1.1.1.1

[top]
Segment boundaries for domain 2essA01

Chopping figure for domain 2essA01
DomainStart PDB ResidueStop PDB Residue
2essA01 2 148
2essA02 149 247

Structural Neighbourhood (17 entries)

There are 17 matching structural neighberhood comparisons for CATH ID 3.10.129.10.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 17 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1njkA00 85.60 Long-chain acyl-CoA thioesterase tesCAcyl-CoA thioesterase activityThioesterase III [EC:3.1.2.-]Fatty acid beta-oxidationEscherichia coli K-12 3.10.129.10 130 10 86 2.07 2.38
2oafA00 84.93 Jannaschia sp. CCS1Thioesterase superfamily 3.10.129.10 135 10 92 3.05 3.31
2oiwA00 84.83 Geobacillus kaustophilusHypothetical conserved protein 3.10.129.10 129 12 89 2.82 3.16
2o5uC00 84.54 Pseudomonas aeruginosaPutative uncharacterized protein 3.10.129.10 140 7 91 3.38 3.70
2nujA01 84.43 Jannaschia sp. CCS1Thioesterase superfamily 3.10.129.10 145 7 88 3.34 3.75
2aliA00 83.72 Pseudomonas aeruginosaPutative uncharacterized protein 3.10.129.10 126 7 86 2.56 2.94
2hljA01 83.18 Pseudomonas putida KT2440Putative uncharacterized protein 3.10.129.10 132 12 90 3.44 3.80
2q2bA00 82.03 Mus musculusCytosolic acyl coenzyme A thioester hydrolaseFatty acid catabolic processPalmitoyl-CoA hydrolase activity 3.10.129.10 141 13 87 4.21 4.79
1wluA00 82.03 Thermus thermophilus HB8Phenylacetic acid degradation protein PaaIPhenylacetic acid degradation protein 3.10.129.10 117 7 73 3.13 4.28
3b7kA02 81.73 Acetyl-CoA hydrolase [EC:3.1.2.1]Pyruvate metabolismHomo sapiensAcyl-coenzyme A thioesterase 12 3.10.129.10 121 11 79 3.43 4.30
3b7kC02 81.30 Acetyl-CoA hydrolase [EC:3.1.2.1]Pyruvate metabolismHomo sapiensAcyl-coenzyme A thioesterase 12 3.10.129.10 110 13 71 2.26 3.15
2pimA00 80.97 Ralstonia eutropha JMP134Phenylacetic acid degradation-related protein 3.10.129.10 127 14 72 3.04 4.20
1zkiA00 79.93 Pseudomonas aeruginosaPhenylacetic acid degradation proteinPutative uncharacterized protein 3.10.129.10 118 10 72 3.37 4.65
2prxA00 79.54 Shewanella loihica PV-4Thioesterase superfamily protein 3.10.129.10 108 12 68 3.32 4.87
1z6bC00 79.50 Fatty acid biosynthesisMetabolic pathways3R-hydroxymyristoyl ACP dehydrase [EC:4.2.1.-]Plasmodium falciparumBeta-hydroxyacyl-ACP dehydratase 3.10.129.10 138 7 72 3.26 4.50
1pn2C01 77.33 Candida tropicalisPeroxisomal hydratase-dehydrogenase-epimerase 3.10.129.10 143 5 78 3.89 4.97
1pn2D02 76.68 Candida tropicalisPeroxisomal hydratase-dehydrogenase-epimerase 3.10.129.10 122 7 66 3.13 4.70
[1]
Displaying entries 1 to 17 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2essA01
SEENKIGTYQFVAEPFHVDFNGRLTGVLGNHLLNCAGFHASDRGFGIATLNEDNYTWVLSRLAIELDEPYQYEKFSVQTW
VENVYRLFTDRNFAVIDKDGKKIGYARSVWAINLNTRKPALHGGSIVDYICDEPCPIEKP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2essA01
GXSEENKIGTYQFVAEPFHVDFNGRLTXGVLGNHLLNCAGFHASDRGFGIATLNEDNYTWVLSRLAIELDEXPYQYEKFS
VQTWVENVYRLFTDRNFAVIDKDGKKIGYARSVWAXINLNTRKPADLLALHGGSIVDYICDEPCPIEKP
BLAST against CATH

[top]
Domain History Events (76)

Domain assigned by cuff on 13 Nov 2007 13:44

nice SSAP result and similar function

Domain assignment manual match h by tronnberg on 07 Sep 2007 09:42

SSAP: 80.6 OV: 71 SEQ: 12. Similar linkage. The query and match are reasonable structual similar, they only differ with a alfa helix. Functionally similar (acyl-acp thioesterase).

Homcheck review by tronnberg on 07 Sep 2007 09:42

SSAP: 80.6 OV: 71 SEQ: 12. Similar linkage. The query and match are reasonable structual similar, they only differ with a alfa helix. Functionally similar (acyl-acp thioesterase).

Flow stage update by tronnberg on 07 Sep 2007 09:42

SSAP: 80.6 OV: 71 SEQ: 12. Similar linkage. The query and match are reasonable structual similar, they only differ with a alfa helix. Functionally similar (acyl-acp thioesterase).

Homcheck allotment by tronnberg on 07 Sep 2007 09:36

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 07 Sep 2007 09:36

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 07 Sep 2007 02:07

Domain "2essA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 07 Sep 2007 02:06

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2essA01

Flow stage update by auto on 06 Sep 2007 23:48

Retrieved PRC_PFAMCATH results for job ID SID7050951309040258 and results inserted.

Domain scan prc pfamcath by auto on 06 Sep 2007 23:47

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 63 results for 2essA01

Update comment by auto on 06 Sep 2007 08:25

PRC_PFAMCATH job SID7050951309040258 is not yet finished.

Prc pfamcath submit by auto on 06 Sep 2007 08:22

The entry "2essA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 08:22

The entry "2essA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Sep 2007 06:40

Retrieved SSAP results for job ID SID1163129479573968 and results inserted.

Domain scan ssap cath by auto on 06 Sep 2007 06:36

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1692 results for 2essA01

Update comment by auto on 05 Sep 2007 19:09

SSAP job SID1163129479573968 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 15:35

The entry "2essA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 15:35

The entry "2essA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 04:55

Retrieved PRC results for job ID SID0890056878595744 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 04:54

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 32 results for 2essA01

Prc cath submit by auto on 04 Sep 2007 13:38

The entry "2essA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 13:38

The entry "2essA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Sep 2007 10:52

Retrieved HMM(SAM) results for job ID SID1186440816171864 and inserted them into the database.

Domain scan sam cath by auto on 04 Sep 2007 10:51

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 2essA01

Sam cath submit by auto on 04 Sep 2007 09:26

The entry "2essA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:26

The entry "2essA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Sep 2007 20:30

Retrieved "2essA01" CATHEDRAL results for job ID SID4764814153174960 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Sep 2007 20:29

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 19 results for 2essA01

Cathedral cath submit by auto on 03 Sep 2007 13:35

The entry "2essA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:35

The entry "2essA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 11:27

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2essA01.scanlist" for "2essA01"

Write scan list by auto on 03 Sep 2007 11:27

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2essA01.scanlist" for domain "2essA01"

Update comment by auto on 03 Sep 2007 10:10

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:30

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:35

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:31

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:19

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:19

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:13

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:25

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:10

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:12

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:13

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:39

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:12

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:29

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:04

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:14

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:10

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:30

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:34

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:14

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:41

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:03

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:21

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:27

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 18:31

Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 14:48

Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 10:12

Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 08:09

Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 02:18

Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 22:19

Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 18:12

Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 14:12

Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 10:24

Waiting for 1921 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 06:30

Waiting for 1975 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Aug 2007 02:23

Waiting for 2046 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 22:18

Waiting for 2103 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 18:24

Waiting for 2173 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Aug 2007 14:22

Waiting for 2242 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 26 Aug 2007 14:21

No satisfactory AssignClose result found.

Flow stage update by auto on 26 Aug 2007 14:09

No in_process hits for Domain "2essA01" ready to be processed

Flow stage update by auto on 26 Aug 2007 14:09

NW result present for Domain "2essA01"

Flow stage update by auto on 21 Aug 2007 10:06

All required files are present for Domain "2essA01"

Flow stage update by auto on 20 Aug 2007 17:33

Beginning processing for Domain "2essA01"

Insertion by cuff on 20 Aug 2007 14:09

nice chopping