CATH Domain: 2erlA00 XML data for domain: 2erlA00

Molscript image for 2erlA00
2erlA00
PDB coordinates for domain 2erlA00

PDB 2erl, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.50 Pheromone ER-1
1.20.50.10 Pheromone ER-1 Gene3D
1.20.50.10.1
1.20.50.10.1.1
1.20.50.10.1.1.1
1.20.50.10.1.1.1.1
1.20.50.10.1.1.1.1.1

[top]
Segment boundaries for domain 2erlA00

Chopping figure for domain 2erlA00
DomainStart PDB ResidueStop PDB Residue
2erlA00 1 40

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.20.50.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1eqnC03 77.83 DNA replicationCytoplasmZinc ion bindingDNA primase [EC:2.7.7.-]DNA primase activity 1.20.50.20 51 2 66 2.47 3.71
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2erlA00
DACEQAAIQCVESACESLCTEGEDRTGCYMYIYSNCPPYV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2erlA00
DACEQAAIQCVESACESLCTEGEDRTGCYMYIYSNCPPYV
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "2erl000" to "2erlA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:39

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"