CATH Domain: 2eq6A03 XML data for domain: 2eq6A03

Molscript image for 2eq6A03
2eq6A03
PDB coordinates for domain 2eq6A03

PDB 2eq6, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.30 Gene3D
3.30.390.30.2
3.30.390.30.2.1
3.30.390.30.2.1.1
3.30.390.30.2.1.1.1
3.30.390.30.2.1.1.1.1

[top]
Segment boundaries for domain 2eq6A03

Chopping figure for domain 2eq6A03
DomainStart PDB ResidueStop PDB Residue
2eq6A01 7 151
2eq6A01 273 345
2eq6A02 152 272
2eq6A03 347 469

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.390.30.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ebdA03 93.62 Dihydrolipoyl dehydrogenaseGeobacillus stearothermophilus 3.30.390.30 115 47 93 0.96 1.03
2a8xA03 92.87 Citrate cycle (TCA cycle)Pyruvate metabolismValine, leucine and isoleucine degradationGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 119 38 96 1.26 1.30
1xdiA03 90.61 Citrate cycle (TCA cycle)Valine, leucine and isoleucine degradationPyruvate metabolismGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 122 29 94 1.90 2.01
2nvkX03 87.58 Protein homodimerization activityThioredoxin reductase 1, mitochondrialDetermination of adult lifespanThioredoxin-disulfide reductase activityGlutathione-disulfide reductase activity 3.30.390.30 115 29 89 1.92 2.15
1nhpA03 86.22 NADH peroxidaseNADH peroxidase [EC:1.11.1.1]Enterococcus faecalis 3.30.390.30 113 21 87 2.69 3.06
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2eq6A03
QVPSVVYTSPEWAGVGLTEEEAKRAGYKVKVGKFPLAASGRALTLGGAEGMVKVVGDEETDLLLGVFIVGPQAGELIAEA
ALALEMGATLTDLALTVHPHPTLSESLMEAAEAFHKQAIHILN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2eq6A03
QVPSVVYTSPEWAGVGLTEEEAKRAGYKVKVGKFPLAASGRALTLGGAEGMVKVVGDEETDLLLGVFIVGPQAGELIAEA
ALALEMGATLTDLALTVHPHPTLSESLMEAAEAFHKQAIHILNR
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 05 Apr 2008 17:30

Assigning to "3.30.390.30" based on similarity with "2eq9J03"

Flow stage update by auto on 05 Apr 2008 17:30

No in_process hits for Domain "2eq6A03" ready to be processed

Update comment by auto on 05 Apr 2008 17:28

Domain "2eq6A03" hits Domain "2eq7B03" (52.0661157024793% over 97.5806451612903%) which is currently in process

Update comment by auto on 05 Apr 2008 17:24

Domain "2eq6A03" hits Domain "2eq9J03" (100% over 100%) which is currently in process

Update comment by auto on 05 Apr 2008 14:18

Domain "2eq6A03" hits Domain "2eq6B03" (100% over 100%) which is currently in process

Flow stage update by auto on 05 Apr 2008 14:07

Domain "2eq6A03" hits Domain "2eq6B03" (100% over 100%) which is currently in process

Flow stage update by auto on 05 Apr 2008 14:07

NW result present for Domain "2eq6A03"

Flow stage update by auto on 05 Apr 2008 08:22

All required files are present for Domain "2eq6A03"

Flow stage update by auto on 04 Apr 2008 08:21

Beginning processing for Domain "2eq6A03"

Insertion by auto on 04 Apr 2008 08:15

Final ChopClose added based on similarity with "1dxlA"