CATH Domain: 2eiyB02 XML data for domain: 2eiyB02

Molscript image for 2eiyB02
2eiyB02
PDB coordinates for domain 2eiyB02

PDB 2eiy, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.10 D-amino Acid Aminotransferase; Chain A, domain 2
3.20.10.10 D-amino Acid Aminotransferase, subunit A, domain 2 Gene3D
3.20.10.10.1
3.20.10.10.1.1
3.20.10.10.1.1.1
3.20.10.10.1.1.1.1
3.20.10.10.1.1.1.1.1

[top]
Segment boundaries for domain 2eiyB02

Chopping figure for domain 2eiyB02
DomainStart PDB ResidueStop PDB Residue
2eiyB01 5 130
2eiyB02 131 294

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.20.10.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3daaA02 90.81 D-alanine:2-oxoglutarate aminotransferase activityPyridoxal phosphate bindingD-amino acid catabolic processBacillus sp. YM-1D-amino acid biosynthetic process 3.20.10.10 159 30 95 1.57 1.65
3cswA02 90.12 Thermotoga maritimaBranched-chain amino acid aminotransferase [EC:2.6.1.42]Valine, leucine and isoleucine degradationProbable branched-chain-amino-acid aminotransferasePantothenate and CoA biosynthesis 3.20.10.10 164 31 95 2.22 2.32
1i2kA02 88.07 Folate biosynthesis4-amino-4-deoxychorismate lyase [EC:4.1.3.38]Escherichia coli K-12Aminodeoxychorismate lyase 3.20.10.10 145 24 87 1.76 2.00
2hg8A02 86.34 Homo sapiensBranched-chain-amino-acid aminotransferase, mitochondrialMitochondrionBranched-chain-amino-acid transaminase activity 3.20.10.10 172 25 88 2.08 2.35
3cebA02 78.74 4-amino-4-deoxychorismate lyase [EC:4.1.3.38]Folate biosynthesisHaemophilus somnus 129PTPutative uncharacterized protein 3.20.10.10 106 14 64 2.36 3.65
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2eiyB02
GEEAVRKGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYAL
EHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEA
VTGR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2eiyB02
GEEAVRKGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYAL
EHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEA
VTGR
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 22 Mar 2008 17:39

Assigning to "3.20.10.10" based on similarity with "1wrvB02"

Flow stage update by auto on 22 Mar 2008 17:38

No in_process hits for Domain "2eiyB02" ready to be processed

Update comment by auto on 22 Mar 2008 17:36

Domain "2eiyB02" hits Domain "2ej2E02" (100% over 97.5609756097561%) which is currently in process

Update comment by auto on 22 Mar 2008 17:33

Domain "2eiyB02" hits Domain "2eiyA02" (100% over 97.5609756097561%) which is currently in process

Update comment by auto on 22 Mar 2008 17:29

Domain "2eiyB02" hits Domain "2ej2D02" (100% over 98.7951807228916%) which is currently in process

Update comment by auto on 22 Mar 2008 17:22

Domain "2eiyB02" hits Domain "2ej0F02" (100% over 98.780487804878%) which is currently in process

Update comment by auto on 22 Mar 2008 11:16

Domain "2eiyB02" hits Domain "2eiyC02" (100% over 96.3414634146341%) which is currently in process

Flow stage update by auto on 22 Mar 2008 11:05

Domain "2eiyB02" hits Domain "2eiyC02" (100% over 96.3414634146341%) which is currently in process

Flow stage update by auto on 22 Mar 2008 11:05

NW result present for Domain "2eiyB02"

Flow stage update by auto on 22 Mar 2008 11:05

All required files are present for Domain "2eiyB02"

Flow stage update by auto on 21 Mar 2008 18:01

Beginning processing for Domain "2eiyB02"

Insertion by auto on 21 Mar 2008 17:58

Final ChopClose added based on similarity with "1wrvA"