CATH Domain: 2e6fA02 XML data for domain: 2e6fA02

Molscript image for 2e6fA02
2e6fA02
PDB coordinates for domain 2e6fA02

PDB 2e6f, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.26 Dihydroorotate Dehydrogenase A; chain A, domain 2
2.30.26.10 Dihydroorotate Dehydrogenase A, chain A, domain 2 Gene3D
2.30.26.10.1
2.30.26.10.1.1
2.30.26.10.1.1.1
2.30.26.10.1.1.1.1
2.30.26.10.1.1.1.1.1

[top]
Segment boundaries for domain 2e6fA02

Chopping figure for domain 2e6fA02
DomainStart PDB ResidueStop PDB Residue
2e6fA01 0 52
2e6fA01 71 195
2e6fA01 222 311
2e6fA02 53 70
2e6fA02 196 221

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2e6fA02
NPEPRYMAFPLGSINSMGVGNGLVIDAESESVVIKPKQGFGGLG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2e6fA02
NPEPRYMAFPLGSINSMGVGNGLVIDAESESVVIKPKQGFGGLG
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 19 Jan 2008 17:24

Assigning to "2.30.26.10" based on similarity with "2djlA02"

Flow stage update by auto on 19 Jan 2008 17:07

No in_process hits for Domain "2e6fA02" ready to be processed

Flow stage update by auto on 19 Jan 2008 17:07

NW result present for Domain "2e6fA02"

Flow stage update by auto on 19 Jan 2008 11:04

All required files are present for Domain "2e6fA02"

Flow stage update by auto on 18 Jan 2008 11:54

Beginning processing for Domain "2e6fA02"

Insertion by auto on 18 Jan 2008 11:09

Final ChopClose added based on similarity with "2e6dA"