Domain assigned by auto on 24 Nov 2007 19:58
Assigning to "3.30.470.20" based on similarity with "2dzdB03"
CATH Domain: 2dzdA03
2dzdA03
PDB 2dzd, Chain A, Domain 3
Segment boundaries for domain 2dzdA03
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2dzdA01 | 3 | 135 |
| 2dzdA02 | 136 | 207 |
| 2dzdA03 | 208 | 461 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2dzdA03 IENPKHIEVQILGDYEGNIVHLYERDCSVQRRHQKVVEVAPSVSLSDELRQRICEAAVQLMRSVGYVNAGTVEFLVSGDE FYFIEVNPRIQVEHTITEMITGIDIVQSQILIADGCSLHSHEVGIPKQEDIRINGYAIQSRVTTEDPLNNFMPDTGKIMA YRSGGGFGVRLDAGNGFQGAVITPYYDSLLVKLSTWALTFEQAARKMLRNLREFRIRGIKTNIPFLENVVQHPKFLSGEY DTSFIDTTPELFVF
Domain History Events (8)
Flow stage update by auto on 24 Nov 2007 19:58
No in_process hits for Domain "2dzdA03" ready to be processed
Update comment by auto on 24 Nov 2007 14:47
Domain "2dzdA03" hits Domain "2dzdB03" (100% over 100%) which is currently in process
Flow stage update by auto on 24 Nov 2007 14:39
Domain "2dzdA03" hits Domain "2dzdB03" (100% over 100%) which is currently in process
Flow stage update by auto on 24 Nov 2007 14:39
NW result present for Domain "2dzdA03"
Flow stage update by auto on 24 Nov 2007 14:37
All required files are present for Domain "2dzdA03"
Flow stage update by auto on 24 Nov 2007 02:36
Beginning processing for Domain "2dzdA03"
Insertion by auto on 23 Nov 2007 18:06
Final ChopClose added based on similarity with "2dzdB"
