CATH Domain: 2dwuA02 XML data for domain: 2dwuA02

Molscript image for 2dwuA02
2dwuA02
PDB coordinates for domain 2dwuA02

PDB 2dwu, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1860 Gene3D
3.40.50.1860.1
3.40.50.1860.1.1
3.40.50.1860.1.1.1
3.40.50.1860.1.1.1.1
3.40.50.1860.1.1.1.1.1

[top]
Segment boundaries for domain 2dwuA02

Chopping figure for domain 2dwuA02
DomainStart PDB ResidueStop PDB Residue
2dwuA01 5 98
2dwuA01 212 269
2dwuA02 99 211

Structural Neighbourhood (38 entries)

There are 38 matching structural neighberhood comparisons for CATH ID 3.40.50.1860.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 38 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jflA02 85.12 Aspartate racemase [EC:5.1.1.13]228aa long hypothetical aspartate racemasePyrococcus horikoshiiAlanine, aspartate and glutamate metabolism 3.40.50.1860 109 18 90 2.43 2.69
2q5cA02 80.21 Clostridium acetobutylicumNtrC family transcriptional regulator (PAS and AAA domains) 3.40.50.10660 89 8 74 2.43 3.27
1bykA02 79.46 Specific transcriptional repressor activityLacI family transcriptional regulator, trehalose operon repressorSequence-specific DNA binding transcription factor activityTranscriptionHTH-type transcriptional regulator treR 3.40.50.2300 117 9 81 2.87 3.53
1jflA01 79.08 Aspartate racemase [EC:5.1.1.13]228aa long hypothetical aspartate racemasePyrococcus horikoshiiAlanine, aspartate and glutamate metabolism 3.40.50.1860 119 15 81 3.56 4.37
2pjuA02 79.03 Positive regulation of gene-specific transcriptionPropionate catabolism operon regulatory proteinNegative regulation of gene-specific transcriptionEscherichia coli K-12Specific transcriptional repressor activity 3.40.50.10660 88 11 76 2.89 3.75
2rgyA02 77.81 LacI family transcriptional regulatorBurkholderia phymatum STM815Transcriptional regulator, LacI family 3.40.50.2300 134 12 72 3.22 4.45
1usgA02 77.39 ABC transportersLeucine-specific-binding proteinBranched-chain amino acid transport system substrate-binding proteinEscherichia coli K-12 3.40.50.2300 144 12 65 3.15 4.77
3brsA02 76.62 Ribose transport system substrate-binding proteinBacterial chemotaxisPeriplasmic binding protein/LacI transcriptional regulatorClostridium phytofermentans ISDgABC transporters 3.40.50.2300 134 14 73 3.19 4.32
3cs3A02 76.54 Sugar-binding transcriptional regulator, LacI familyLacI family transcriptional regulatorEnterococcus faecalis 3.40.50.2300 135 7 70 3.08 4.38
1jr2A01 76.42 Uroporphyrinogen-III synthase [EC:4.2.1.75]Metabolic pathwaysPorphyrin and chlorophyll metabolismUroporphyrinogen-III synthase activityHomo sapiens 3.40.50.10090 120 5 60 2.66 4.37
3lftA02 76.35 Putative ABC transport system substrate-binding proteinStreptococcus pneumoniaePutative uncharacterized protein 3.40.50.2300 137 9 63 2.76 4.35
2hqbA02 76.23 Transcriptional activator of comK geneTranscriptional activator of comK geneBacillus halodurans 3.40.50.2300 148 12 63 3.05 4.80
1jyeA02 76.02 Lactose operon repressorProtein bindingEscherichia coli K-12Cytosol 3.40.50.2300 141 7 68 2.95 4.29
3ctpA02 75.97 Alkaliphilus metalliredigens QYMFPeriplasmic binding protein/LacI transcriptional regulator 3.40.50.2300 138 8 71 3.36 4.68
1jyeA01 75.95 Lactose operon repressorProtein bindingEscherichia coli K-12Cytosol 3.40.50.2300 130 10 63 2.98 4.72
1b73A01 75.89 Glutamate racemaseAquifex pyrophilus 3.40.50.1860 143 11 63 2.87 4.51
3ckmA02 75.81 Haemophilus influenzaeUncharacterized protein HI_1655 3.40.50.2300 135 7 67 2.64 3.92
2q5cA01 75.79 Clostridium acetobutylicumNtrC family transcriptional regulator (PAS and AAA domains) 3.40.50.2300 97 13 64 2.71 4.19
3bilA02 75.68 Corynebacterium glutamicumPROBABLE LACI-FAMILY TRANSCRIPTIONAL REGULATOR 3.40.50.2300 136 11 71 3.08 4.32
2driA02 75.63 Bacterial chemotaxisABC transportersD-ribose-binding periplasmic proteinRibose transport system substrate-binding proteinMembrane 3.40.50.2300 146 9 64 2.92 4.54
3clkA02 75.08 Lactobacillus plantarumTranscription regulator 3.40.50.2300 137 12 69 3.43 4.95
3eq2B01 75.07 Pseudomonas aeruginosaProbable two-component response regulator 3.40.50.2300 103 11 67 3.10 4.61
2hqbA01 75.07 Transcriptional activator of comK geneTranscriptional activator of comK geneBacillus halodurans 3.40.50.2300 130 8 61 2.84 4.62
1vrvA00 74.96 Phosphotransferase system (PTS)Fructose and mannose metabolismPTS system, mannitol-specific IIC componentPTS system, mannitol-specific IIA component [EC:2.7.1.69]PTS system, mannitol-specific IIB component [EC:2.7.1.69] 3.40.50.10370 96 14 61 2.86 4.62
1jx6A02 74.82 Vibrio cholerae pathogenic cycleVibrio harveyiAutoinducer 2-binding periplasmic protein LuxPProtein bindingAutoinducer 2-binding periplasmic protein luxP 3.40.50.2300 151 12 64 3.04 4.68
2fepA02 74.77 Bacillus subtilisCatabolite control protein ALacI family transcriptional regulator 3.40.50.2300 140 14 68 2.91 4.24
3c3mA00 74.45 Response regulator receiver proteinMethanoculleus marisnigri JR1 3.40.50.2300 104 8 61 3.08 4.97
1dz3A00 74.31 Geobacillus stearothermophilusStage 0 sporulation protein A 3.40.50.2300 123 7 61 2.67 4.32
2fvyA02 74.26 Bacterial chemotaxisABC transportersMethyl-galactoside transport system substrate-binding proteinD-galactose-binding periplasmic proteinEscherichia coli K-12 3.40.50.2300 157 7 61 3.04 4.97
1a04A01 74.12 Two-component systemTwo-component system, NarL family, nitrate/nitrite response regulator NarLProtein bindingEscherichia coli K-12Nitrate/nitrite response regulator protein narL 3.40.50.2300 124 7 62 2.96 4.77
3c3kA02 73.99 Actinobacillus succinogenes 130ZAlanine racemase 3.40.50.2300 138 12 71 3.26 4.54
2pjuC01 73.68 Positive regulation of gene-specific transcriptionPropionate catabolism operon regulatory proteinNegative regulation of gene-specific transcriptionEscherichia coli K-12Specific transcriptional repressor activity 3.40.50.2300 100 13 67 3.26 4.85
3d8uB01 73.61 Putative transcriptional regulatorVibrio parahaemolyticusLacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor 3.40.50.2300 119 7 66 3.14 4.73
3d8uA02 73.38 Putative transcriptional regulatorVibrio parahaemolyticusLacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor 3.40.50.2300 144 13 68 3.19 4.64
3bblA02 72.73 Chloroflexus aggregans DSM 9485LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupGTranscriptional regulator, LacI family 3.40.50.2300 137 10 67 3.29 4.90
2jk1A00 72.37 Hydrogenase transcriptional regulatory protein hupR1Rhodobacter capsulatus 3.40.50.2300 138 7 52 2.57 4.93
1s8nA01 72.37 Response regulator NasTProbable transcriptional regulatory protein pdtaRMycobacterium tuberculosis 3.40.50.2300 132 7 56 2.69 4.73
3ce9A01 72.00 Glycerol dehydrogenaseClostridium acetobutylicum 3.40.50.1970 153 8 60 2.87 4.77
[1]
Displaying entries 1 to 38 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2dwuA02
VIHPGARAAIKVTKKGKIGVIGTVGTIQSNMYEKALHELDTYLKVHSHACPTLATVVENRLEDTAYVTQQVKQALLPLTK
EDIDTLILGCTHYPLLESYIKKELGEDVTIISS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2dwuA02
VIHPGARAAIKVTKKGKIGVIGTVGTIQSNMYEKALHELDTYLKVHSHACPTLATVVENRLEDTAYVTQQVKQALLPLTK
EDIDTLILGCTHYPLLESYIKKELGEDVTIISS
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 15 Aug 2007 04:14

Assigning to "3.40.50.1860" based on similarity with "2dwuB02"

Flow stage update by auto on 15 Aug 2007 04:01

No in_process hits for Domain "2dwuA02" ready to be processed

Update comment by auto on 15 Aug 2007 03:22

Domain "2dwuA02" hits Domain "2gzmD02" (46.9026548672566% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 02:39

Domain "2dwuA02" hits Domain "2gzmB02" (46.9026548672566% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 01:39

Domain "2dwuA02" hits Domain "2gzmC02" (46.9026548672566% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 00:07

Domain "2dwuA02" hits Domain "1zuwB02" (53.9823008849558% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:50

Domain "2dwuA02" hits Domain "1zuwC02" (53.9823008849558% over 100%) which is currently in process

Flow stage update by auto on 23 Jul 2007 22:42

Domain "2dwuA02" hits Domain "2dwuB02" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Jul 2007 22:42

NW result present for Domain "2dwuA02"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2dwuA02"

Flow stage update by auto on 15 Jul 2007 07:07

Beginning processing for Domain "2dwuA02"

Insertion by auto on 15 Jul 2007 06:22

Final ChopClose added based on similarity with "1zuwA"