CATH Domain: 2dwcA03 XML data for domain: 2dwcA03

Molscript image for 2dwcA03
2dwcA03
PDB coordinates for domain 2dwcA03

PDB 2dwc, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.470 D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.20 ATP-grasp fold, B domain Gene3D
3.30.470.20.1
3.30.470.20.1.2
3.30.470.20.1.2.1
3.30.470.20.1.2.1.1
3.30.470.20.1.2.1.1.1

[top]
Segment boundaries for domain 2dwcA03

Chopping figure for domain 2dwcA03
DomainStart PDB ResidueStop PDB Residue
2dwcA01 2 131
2dwcA02 132 203
2dwcA03 204 422

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.470.20.1.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ethA02 84.45 Purine metabolismMetabolic pathways5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]Phosphoribosylaminoimidazole carboxylase ATPase subunitEscherichia coli K-12 3.30.470.20 223 20 82 2.69 3.26
1a9xA06 81.05 3.30.470.20 203 13 81 4.07 4.98
2qf7B03 78.93 Pyruvate carboxylase subunit A [EC:6.4.1.1]Citrate cycle (TCA cycle)Rhizobium etli CFN 42Pyruvate carboxylase subunit B [EC:6.4.1.1]Pyruvate metabolism 3.30.470.20 248 17 74 2.88 3.88
1gsoA03 75.82 Purine metabolismMetabolic pathwaysPhosphoribosylamine--glycine ligase [EC:6.3.4.13]Phosphoribosylamine--glycine ligaseEscherichia coli K-12 3.30.470.20 139 9 61 2.84 4.59
1vkzA03 74.82 Thermotoga maritimaPhosphoribosylamine--glycine ligase [EC:6.3.4.13]Purine metabolismPhosphoribosylamine--glycine ligaseMetabolic pathways 3.30.470.20 129 11 59 2.82 4.72
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2dwcA03
HIDFDVEVTELAVRHFDENGEIVTTFPKPVGHYQIDGDYHASWQPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVK
GDKVWANEVSPRPHDTGMVTLASHPPGFSEFALHLRAVLGLPIPGEWVDGYRLFPMLIPAATHVIKAKVSGYSPRFRGLV
KALSVPNATVRLFGKPEAYVGRRLGIALAWDKDVEVAKRKAEMVAHMIELRTRSSDWHD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2dwcA03
HIDFDVEVTELAVRHFDENGEIVTTFPKPVGHYQIDGDYHASWQPAEISEKAEREVYRIAKRITDVLGGLGIFGVEMFVK
GDKVWANEVSPRPHDTGMVTLASHPPGFSEFALHLRAVLGLPIPGEWVDGYRLFPMLIPAATHVIKAKVSGYSPRFRGLV
KALSVPNATVRLFGKPEAYVGRRLGIALAWDKDVEVAKRKAEMVAHMIELRTRSSDWHDQNYEKRKHLLR
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 28 Jun 2007 02:07

Assigning to "3.30.470.20" based on similarity with "2czgA03"

Flow stage update by auto on 28 Jun 2007 02:05

No in_process hits for Domain "2dwcA03" ready to be processed

Update comment by auto on 27 Jun 2007 22:03

Domain "2dwcA03" hits Domain "2dwcB03" (100% over 100%) which is currently in process

Flow stage update by auto on 01 Apr 2007 21:59

Domain "2dwcA03" hits Domain "2dwcB03" (100% over 100%) which is currently in process

Flow stage update by auto on 01 Apr 2007 21:59

NW result present for Domain "2dwcA03"

Flow stage update by auto on 31 Mar 2007 21:59

All required files are present for Domain "2dwcA03"

Flow stage update by auto on 30 Mar 2007 22:00

Beginning processing for Domain "2dwcA03"

Insertion by auto on 30 Mar 2007 21:56

Final ChopClose added based on similarity with "2czgA"