CATH Domain: 2dvmA01 XML data for domain: 2dvmA01

Molscript image for 2dvmA01
2dvmA01
PDB coordinates for domain 2dvmA01

PDB 2dvm, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.10380 Aminoacid dehydrogenase-like, N-terminal domain. Chain A Gene3D
3.40.50.10380.2
3.40.50.10380.2.1
3.40.50.10380.2.1.1
3.40.50.10380.2.1.1.1
3.40.50.10380.2.1.1.1.1

[top]
Segment boundaries for domain 2dvmA01

Chopping figure for domain 2dvmA01
DomainStart PDB ResidueStop PDB Residue
2dvmA01 2 159
2dvmA02 160 439

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2dvmA01
IREKALEFHKNNFPGNGKIEVIPKVSLESREELTLAYTPGVAEPCKEIARDPGKVYEYTSKGNLVAVVSDGSRILGLGNI
GPLAGLPVMEGKALLFKRFGGVDAFPIMIKEQEPNKFIDIVKAIAPTFGGINLEDIASPKCFYILERLREELDIPVFH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2dvmA01
MIREKALEFHKNNFPGNGKIEVIPKVSLESREELTLAYTPGVAEPCKEIARDPGKVYEYTSKGNLVAVVSDGSRILGLGN
IGPLAGLPVMEGKALLFKRFGGVDAFPIMIKEQEPNKFIDIVKAIAPTFGGINLEDIASPKCFYILERLREELDIPVFH
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 24 Nov 2007 19:58

Assigning to "3.40.50.10380" based on similarity with "2dvmD01"

Flow stage update by auto on 24 Nov 2007 19:57

No in_process hits for Domain "2dvmA01" ready to be processed

Update comment by auto on 24 Nov 2007 14:47

Domain "2dvmA01" hits Domain "2dvmD01" (100% over 100%) which is currently in process

Flow stage update by auto on 24 Nov 2007 14:39

Domain "2dvmA01" hits Domain "2dvmD01" (100% over 100%) which is currently in process

Flow stage update by auto on 24 Nov 2007 14:39

NW result present for Domain "2dvmA01"

Flow stage update by auto on 24 Nov 2007 14:37

All required files are present for Domain "2dvmA01"

Flow stage update by auto on 24 Nov 2007 02:36

Beginning processing for Domain "2dvmA01"

Insertion by auto on 23 Nov 2007 18:04

Final ChopClose added based on similarity with "2dvmD"