CATH Domain: 2dsaA02 XML data for domain: 2dsaA02

Molscript image for 2dsaA02
2dsaA02
PDB coordinates for domain 2dsaA02

PDB 2dsa, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.21
1.20.1050.10.21.1
1.20.1050.10.21.1.1
1.20.1050.10.21.1.1.1
1.20.1050.10.21.1.1.1.1

[top]
Segment boundaries for domain 2dsaA02

Chopping figure for domain 2dsaA02
DomainStart PDB ResidueStop PDB Residue
2dsaA01 1 82
2dsaA01 189 200
2dsaA02 83 188

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.21.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1hqoA02 86.99 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 15 80 1.62 2.02
1aw9A02 86.87 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 21 85 2.65 3.11
1gnwA02 86.27 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 10 84 2.42 2.85
1v2aA02 86.10 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 22 79 2.13 2.68
2gsqA02 85.42 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 14 91 2.14 2.33
1gwcA02 83.72 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 19 73 2.15 2.91
1nhyA02 81.77 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 9 75 2.23 2.95
3cbuA02 81.07 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 15 75 2.88 3.80
2c3nA02 80.50 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 18 65 2.23 3.40
1qsdA00 76.25 Beta-tubulin bindingPost-chaperonin tubulin folding pathwayCytoplasmMicrotubule cytoskeleton organizationSaccharomyces cerevisiae 1.20.58.90 102 3 66 3.17 4.80
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2dsaA02
APANGSFERYHLQQWLNFISSELHKSFSPLFNPASSDEWKNAVRQSLNTRLGQVARQLEHAPYLLGDQLSVADIYLFVVL
GWSAYVNIDLSPWPSLQAFQGRVGGR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2dsaA02
APANGSFERYHLQQWLNFISSELHKSFSPLFNPASSDEWKNAVRQSLNTRLGQVARQLEHAPYLLGDQLSVADIYLFVVL
GWSAYVNIDLSPWPSLQAFQGRVGGR
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 02 Dec 2006 13:21

Assigning to "1.20.1050.10" based on similarity with "2gdrC02"

Flow stage update by auto on 02 Dec 2006 13:19

No in_process hits for Domain "2dsaA02" ready to be processed

Update comment by auto on 02 Dec 2006 09:20

Domain "2dsaA02" hits Domain "2dsaB02" (100% over 100%) which is currently in process

Flow stage update by auto on 02 Dec 2006 09:18

Domain "2dsaA02" hits Domain "2dsaB02" (100% over 100%) which is currently in process

Flow stage update by auto on 02 Dec 2006 09:18

NW result present for Domain "2dsaA02"

Flow stage update by auto on 30 Nov 2006 17:21

All required files are present for Domain "2dsaA02"

Flow stage update by auto on 29 Nov 2006 13:24

Beginning processing for Domain "2dsaA02"

Insertion by auto on 29 Nov 2006 13:23

Final ChopClose added based on similarity with "2gdrA"