CATH Domain: 2dpmA02 XML data for domain: 2dpmA02

Molscript image for 2dpmA02
2dpmA02
PDB coordinates for domain 2dpmA02

PDB 2dpm, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1020 Adenine-specific Methyltransferase; domain 2
1.10.1020.10 Adenine-specific Methyltransferase, Domain 2 Gene3D
1.10.1020.10.1
1.10.1020.10.1.1
1.10.1020.10.1.1.1
1.10.1020.10.1.1.1.1
1.10.1020.10.1.1.1.1.1

[top]
Segment boundaries for domain 2dpmA02

Chopping figure for domain 2dpmA02
DomainStart PDB ResidueStop PDB Residue
2dpmA01 10 64
2dpmA01 168 284
2dpmA02 65 167

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.1020.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1yf3A02 82.51 DNA adenine methylaseEnterobacteria phage T4 1.10.1020.10 95 17 88 3.35 3.79
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2dpmA02
AELINCYQQIKDNPQELIEILKVHQEYNSKEYYLDLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFNVP
YGRYKNPKIVDEELISAISVYIN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2dpmA02
AELINCYQQIKDNPQELIEILKVHQEYNSKEYYLDLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFNVP
YGRYKNPKIVDEELISAISVYIN
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:15

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:15

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:54

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"