Domain assigned by auto on 12 Jul 2007 14:06
Assigning to "3.30.300.10" based on similarity with "2dplB02"
CATH Domain: 2dplA02
2dplA02
PDB 2dpl, Chain A, Domain 2
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.30
| 2-Layer Sandwich | |
 3.30.300
| GMP Synthetase; Chain A, domain 3 | |
 3.30.300.10
| Gene3D | |
 3.30.300.10.2
| ||
 3.30.300.10.2.1
| ||
 3.30.300.10.2.1.1
| ||
 3.30.300.10.2.1.1.1
| ||
 3.30.300.10.2.1.1.1.1
|
Segment boundaries for domain 2dplA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2dplA01 | 1 | 185 |
| 2dplA02 | 186 | 308 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.300.10.2.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
|
2vqeC01 | 76.12 | 3.30.300.20 | 91 | 5 | 68 | 3.28 | 4.80 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2dplA02 MPFPGPGLAVRVIGEVTPEKIRIVREANAIVEEEVERAGLRPWQAFAVLLGVKTVGVQGDIRAYKETIAVRIVESIDGMT ANAMNVPWEVLQRIAFRITSEIPEVGRVLYDITNKPPATIEFE
Domain History Events (8)
Flow stage update by auto on 12 Jul 2007 14:06
No in_process hits for Domain "2dplA02" ready to be processed
Update comment by auto on 12 Jul 2007 12:19
Domain "2dplA02" hits Domain "2dplB02" (100% over 100%) which is currently in process
Flow stage update by auto on 12 Jul 2007 12:16
Domain "2dplA02" hits Domain "2dplB02" (100% over 100%) which is currently in process
Flow stage update by auto on 12 Jul 2007 12:16
NW result present for Domain "2dplA02"
Flow stage update by auto on 07 Jul 2007 20:00
All required files are present for Domain "2dplA02"
Flow stage update by auto on 06 Jul 2007 14:25
Beginning processing for Domain "2dplA02"
Insertion by auto on 06 Jul 2007 14:02
Final ChopClose added based on similarity with "2dplB"
