CATH Domain: 2dkjA01 XML data for domain: 2dkjA01

Molscript image for 2dkjA01
2dkjA01
PDB coordinates for domain 2dkjA01

PDB 2dkj, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.1
3.90.1150.10.1.1
3.90.1150.10.1.1.1
3.90.1150.10.1.1.1.1
3.90.1150.10.1.1.1.1.1

[top]
Segment boundaries for domain 2dkjA01

Chopping figure for domain 2dkjA01
DomainStart PDB ResidueStop PDB Residue
2dkjA01 6 32
2dkjA01 285 407
2dkjA02 33 284

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rv3A01 91.38 Oryctolagus cuniculusSerine hydroxymethyltransferase, cytosolic 3.90.1150.10 170 45 83 1.02 1.22
1eluA01 78.79 Synechocystis sp. PCC 6714L-cysteine/cystine lyase C-DES 3.90.1150.10 115 10 67 3.09 4.59
1m32A01 78.28 2-aminoethylphosphonate--pyruvate transaminaseSalmonella enterica subsp. enterica serovar Typhimurium2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]Phosphonate and phosphinate metabolismMetabolic pathways 3.90.1150.10 110 12 64 2.35 3.67
1bs0A01 78.06 Biotin metabolismMetabolic pathways8-amino-7-oxononanoate synthase [EC:2.3.1.47]8-amino-7-oxononanoate synthase activityBiotin biosynthetic process 3.90.1150.10 132 8 70 3.53 5.00
1iugA01 77.06 Thermus thermophilusAspartate aminotransferase 3.90.1150.10 111 12 68 3.13 4.60
1eg5B01 76.39 Thermotoga maritimaThiamine metabolismCysteine desulfurase [EC:2.8.1.7]Aminotransferase, class V 3.90.1150.10 106 14 60 2.92 4.81
2qmaA02 76.05 Diaminobutyrate-2-oxoglutarate transaminase [EC:2.6.1.76]Vibrio parahaemolyticusGlycine, serine and threonine metabolismDiaminobutyrate-pyruvate transaminase & L-2,4-diaminobutyrate decarboxylaseMetabolic pathways 3.90.1150.10 122 4 66 2.97 4.46
1p3wA01 75.89 Thiamine metabolismCysteine desulfurase activitySelenocysteine lyase activityCysteine desulfuraseIron-sulfur cluster assembly 3.90.1150.10 121 9 66 3.15 4.72
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2dkjA01
KRDEALFELIALEEKRQREGLELIASELVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGI
TVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2dkjA01
MVSTLKRDEALFELIALEEKRQREGLELIASELVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERL
DAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 23 Jul 2007 14:44

Assigning to "3.90.1150.10" based on similarity with "1kkjA01"

Flow stage update by auto on 23 Jul 2007 14:39

No in_process hits for Domain "2dkjA01" ready to be processed

Flow stage update by auto on 23 Jul 2007 14:39

NW result present for Domain "2dkjA01"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2dkjA01"

Flow stage update by auto on 14 Jul 2007 06:01

Beginning processing for Domain "2dkjA01"

Insertion by auto on 14 Jul 2007 04:39

Final ChopClose added based on similarity with "2dkjB"