CATH Domain: 2d5bA03 XML data for domain: 2d5bA03

Molscript image for 2d5bA03
2d5bA03
PDB coordinates for domain 2d5bA03

PDB 2d5b, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.730 Isoleucyl-tRNA Synthetase; Domain 1
1.10.730.10 Isoleucyl-tRNA Synthetase; Domain 1 Gene3D
1.10.730.10.2
1.10.730.10.2.1
1.10.730.10.2.1.1
1.10.730.10.2.1.1.1
1.10.730.10.2.1.1.1.1

[top]
Segment boundaries for domain 2d5bA03

Chopping figure for domain 2d5bA03
DomainStart PDB ResidueStop PDB Residue
2d5bA01 1 115
2d5bA01 227 336
2d5bA02 116 226
2d5bA03 337 500

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.730.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rqgA04 86.88 Aminoacyl-tRNA biosynthesisSelenoamino acid metabolismPyrococcus abyssiMethionyl-tRNA synthetaseMethionyl-tRNA synthetase [EC:6.1.1.10] 1.10.730.10 151 25 87 1.80 2.05
1wkbA03 79.70 Leucyl-tRNA synthetase [EC:6.1.1.4]Aminoacyl-tRNA biosynthesisPyrococcus horikoshiiLeucyl-tRNA synthetaseValine, leucine and isoleucine biosynthesis 1.10.730.10 121 14 70 2.56 3.65
1qu3A04 77.78 Aminoacyl-tRNA biosynthesisIsoleucyl-tRNA synthetase [EC:6.1.1.5]Isoleucyl-tRNA synthetaseStaphylococcus aureusValine, leucine and isoleucine biosynthesis 1.10.730.10 150 10 81 3.51 4.30
1f7uA02 75.43 Aminoacyl-tRNA biosynthesisArginyl-tRNA synthetase, cytoplasmicArginine-tRNA ligase activityArginyl-tRNA synthetase [EC:6.1.1.19]Arginyl-tRNA aminoacylation 1.10.730.10 125 8 71 3.42 4.79
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2d5bA03
SEEALRTRYEADLADDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAGRLRPLVRELKFHVALEEAMAYVKALNR
YINEKKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIPEEAPVL
FPKK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2d5bA03
SEEALRTRYEADLADDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAGRLRPLVRELKFHVALEEAMAYVKALNR
YINEKKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIPEEAPVL
FPKK
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 11 Jan 2007 15:50

Assigning to "1.10.730.10" based on similarity with "1a8h003"

Flow stage update by auto on 11 Jan 2007 15:48

No in_process hits for Domain "2d5bA03" ready to be processed

Update comment by auto on 11 Jan 2007 11:53

Domain "2d5bA03" hits Domain "2d54A03" (100% over 98.7951807228916%) which is currently in process

Flow stage update by auto on 11 Jan 2007 11:47

Domain "2d5bA03" hits Domain "2d54A03" (100% over 98.7951807228916%) which is currently in process

Flow stage update by auto on 11 Jan 2007 11:47

NW result present for Domain "2d5bA03"

Flow stage update by auto on 09 Jan 2007 15:38

All required files are present for Domain "2d5bA03"

Flow stage update by auto on 08 Jan 2007 23:41

Beginning processing for Domain "2d5bA03"

Insertion by auto on 08 Jan 2007 23:23

Final ChopClose added based on similarity with "1woyA"