CATH Domain: 2d48A00

2d48A00

PDB 2d48, Chain A, Domain 0

CATH Code	Level Description	Links
1	Mainly Alpha
1.20	Up-down Bundle
1.20.1250	Growth Hormone; Chain: A;
1.20.1250.10		Gene3D
1.20.1250.10.1
1.20.1250.10.1.1
1.20.1250.10.1.1.1
1.20.1250.10.1.1.1.1
1.20.1250.10.1.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2d48A00

Domain	Start PDB Residue	Stop PDB Residue
2d48A00	1	129

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.20.1250.10.1.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
3l5xA00	84.32	Cellular component movementCytokine activitySoluble fractionHomo sapiensInterleukin-13	1.20.1250.10	101	18	73	2.43	3.30
1m48B00	82.78	Jak-STAT signaling pathwayType I diabetes mellitusAutoimmune thyroid diseaseChagas diseaseIntestinal immune network for IgA production	1.20.1250.10	126	12	86	3.01	3.47
1eteA00	80.08	Pathways in cancerSoluble fractionHematopoietic cell lineagePositive regulation of cell proliferationSignal transduction	1.20.1250.10	134	7	79	3.47	4.35

[top]
Domain ATOM Sequence

>pdb|2d48A00
HKCDITLQEIIKDLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLI
RFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2d48A00
HKCDITLQEIIKDLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLI
RFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

BLAST against CATH

[top]
Domain History Events (16)

Domain assigned by auto on 02 Nov 2006 14:31

Assigning to "1.20.1250.10" based on similarity with "2int000"

Flow stage update by auto on 02 Nov 2006 14:25

No in_process hits for Domain "2d48A00" ready to be processed

Update comment by auto on 02 Nov 2006 10:07

Domain "2d48A00" hits Domain "2b8xA00" (98.4496124031008% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 06:12

Domain "2d48A00" hits Domain "2b8zA00" (98.4496124031008% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 03:17

Domain "2d48A00" hits Domain "2b8yA00" (99.2248062015504% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 21:56

Domain "2d48A00" hits Domain "2b8uA00" (99.2248062015504% over 100%) which is currently in process