CATH Domain: 2d29A03 XML data for domain: 2d29A03

Molscript image for 2d29A03
2d29A03
PDB coordinates for domain 2d29A03

PDB 2d29, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.140 Butyryl-CoA Dehydrogenase, subunit A; domain 3
1.20.140.10 Butyryl-CoA Dehydrogenase, subunit A, domain 3 Gene3D
1.20.140.10.1
1.20.140.10.1.1
1.20.140.10.1.1.1
1.20.140.10.1.1.1.1
1.20.140.10.1.1.1.1.1

Segment boundaries for domain 2d29A03

Chopping figure for domain 2d29A03
DomainStart PDB ResidueStop PDB Residue
2d29A01 5 122
2d29A02 123 233
2d29A03 236 384

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 1.20.140.10.1.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rx0A03 94.00 Lipid metabolic processIsobutyryl-CoA dehydrogenase [EC:1.3.99.-]Valine, leucine and isoleucine degradationHomo sapiensIsobutyryl-CoA dehydrogenase, mitochondrial 1.20.140.10 155 39 96 1.06 1.10
2pg0A03 93.95 Fatty acid metabolismGeobacillus kaustophilusValine, leucine and isoleucine degradationPropanoate metabolismMetabolic pathways 1.20.140.10 149 36 100 1.05 1.05
1ivhA03 93.02 Isovaleryl-CoA dehydrogenase, mitochondrialHomo sapiens 1.20.140.10 141 38 93 1.10 1.17
1siqA03 92.82 Fatty acid metabolismGlutaryl-CoA dehydrogenase [EC:1.3.99.7]Glutaryl-CoA dehydrogenase activityHomo sapiensGlutaryl-CoA dehydrogenase, mitochondrial 1.20.140.10 155 26 95 1.18 1.24
1r2jA03 92.41 Streptomyces hygroscopicus subsp. ascomyceticusFkbI 1.20.140.10 144 31 94 1.18 1.25
2uxwA01 89.47 Fatty acid metabolismEnergy derivation by oxidation of organic compoundsMitochondrial nucleoidMetabolic pathwaysVery long-chain specific acyl-CoA dehydrogenase, mitochondrial 1.20.140.10 186 37 80 1.03 1.29
2rfqC03 84.98 Rhodococcus jostii RHA13-HSA hydroxylase, oxygenase 1.20.140.10 169 18 81 2.36 2.91
2or0A03 82.22 Rhodococcus jostii RHA1Hydroxylase 1.20.140.10 179 24 81 2.55 3.13
1w07A04 80.27 Fatty acid metabolismBiosynthesis of plant hormonesLong-chain fatty acid metabolic processMetabolic pathwaysArabidopsis thaliana 1.20.140.10 129 8 77 3.28 4.21
1u8vB03 79.31 Gamma-aminobutyrate metabolism dehydratase/isomeraseClostridium aminobutyricum 1.20.140.10 213 16 67 2.60 3.85
1dkxA02 76.18 RNA degradationCytoplasmZinc ion bindingMolecular chaperone DnaKChaperone protein dnaK 1.20.1270.10 80 8 53 2.41 4.49
Displaying entries 1 to 11 (page 1 of 1)


Domain ATOM Sequence

>pdb|2d29A03
KGFYDVLRVLDGGRIGIAAMAVGLGQAALDYALAYAKGREAFGRPIAEFEGVSFKLAEAATELEAARLLYLKAAELKDAG
RPFTLEAAQAKLFASEAAVKACDEAIQILGGYGYVKDYPVERYWRDARLTRIGEGTSEILKLVIARRLL    

Domain COMBS Sequence

>pdb|2d29A03
KGFYDVLRVLDGGRIGIAAMAVGLGQAALDYALAYAKGREAFGRPIAEFEGVSFKLAEAATELEAARLLYLKAAELKDAG
RPFTLEAAQAKLFASEAAVKACDEAIQILGGYGYVKDYPVERYWRDARLTRIGEGTSEILKLVIARRLL    

Domain History Events (16)

Domain assigned by auto on 02 Nov 2006 14:31

Assigning to "1.20.140.10" based on similarity with "1ws9A03"

Flow stage update by auto on 02 Nov 2006 14:25

No in_process hits for Domain "2d29A03" ready to be processed

Update comment by auto on 02 Nov 2006 10:07

Domain "2d29A03" hits Domain "2cx9D03" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 06:12

Domain "2d29A03" hits Domain "2cx9A03" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 03:17

Domain "2d29A03" hits Domain "2cx9C03" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 21:56

Domain "2d29A03" hits Domain "2cx9B03" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 18:04

Domain "2d29A03" hits Domain "1ws9A03" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 14:28

Domain "2d29A03" hits Domain "1ws9B03" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "2d29A03" hits Domain "1ws9B03" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2d29A03" hits Domain "1ws9B03" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "2d29A03" hits Domain "1ws9B03" (100% over 100%) which is currently in process

Flow stage update by auto on 31 Oct 2006 14:04

Domain "2d29A03" hits Domain "1ws9B03" (100% over 100%) which is currently in process

Flow stage update by auto on 31 Oct 2006 14:04

NW result present for Domain "2d29A03"

Flow stage update by auto on 28 Oct 2006 13:45

All required files are present for Domain "2d29A03"

Flow stage update by auto on 28 Oct 2006 05:49

Beginning processing for Domain "2d29A03"

Insertion by auto on 28 Oct 2006 05:18

Final ChopClose added based on similarity with "1ws9A"