CATH Domain: 2d29A01

2d29A01

PDB 2d29, Chain A, Domain 1

CATH Code	Level Description	Links
1	Mainly Alpha
1.10	Orthogonal Bundle
1.10.540	Butyryl-Coa Dehydrogenase, subunit A; domain 1
1.10.540.10	Butyryl-Coa Dehydrogenase, subunit A, domain 1	Gene3D
1.10.540.10.1
1.10.540.10.1.1
1.10.540.10.1.1.1
1.10.540.10.1.1.1.1
1.10.540.10.1.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2d29A01

Domain	Start PDB Residue	Stop PDB Residue
2d29A01	5	122
2d29A02	123	233
2d29A03	236	384

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 1.10.540.10.1.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
2vigA01	93.15	Fatty acid metabolismButyryl-CoA dehydrogenase [EC:1.3.99.2]Short-chain specific acyl-CoA dehydrogenase, mitochondrialValine, leucine and isoleucine degradationMetabolic pathways	1.10.540.10	116	31	98	0.97	0.99
1rx0C01	91.26	Lipid metabolic processIsobutyryl-CoA dehydrogenase [EC:1.3.99.-]Valine, leucine and isoleucine degradationHomo sapiensIsobutyryl-CoA dehydrogenase, mitochondrial	1.10.540.10	123	28	95	1.35	1.42
1bucA01	90.40	Acyl-CoA dehydrogenase, short-chain specificMegasphaera elsdenii	1.10.540.10	123	33	95	1.70	1.77
2pg0A01	90.18	Fatty acid metabolismGeobacillus kaustophilusValine, leucine and isoleucine degradationPropanoate metabolismMetabolic pathways	1.10.540.10	117	27	99	1.63	1.64
1siqA01	90.16	Fatty acid metabolismGlutaryl-CoA dehydrogenase [EC:1.3.99.7]Glutaryl-CoA dehydrogenase activityHomo sapiensGlutaryl-CoA dehydrogenase, mitochondrial	1.10.540.10	128	25	91	1.53	1.67
1ukwA01	89.81	Geraniol degradationThermus thermophilus HB27[EC:1.3.99.-]Putative acyl-CoA dehydrogenase1- and 2-Methylnaphthalene degradation	1.10.540.10	116	34	96	1.49	1.54
1r2jA01	88.58	Streptomyces hygroscopicus subsp. ascomyceticusFkbI	1.10.540.10	103	29	87	1.47	1.68
2rfqB01	83.70	Rhodococcus jostii RHA13-HSA hydroxylase, oxygenase	1.10.540.10	102	19	86	2.51	2.90
2ddhA01	80.56	Fatty acid metabolismPeroxisomeRattus norvegicusPPAR signaling pathwayPalmitoyl-CoA oxidase activity	1.10.540.10	118	6	85	3.63	4.24

[top]
Domain ATOM Sequence

>pdb|2d29A01
FEEGAEERQVLGPFREFLKAEVAPGAAERDRTGAFPWDLVRKLAEFGVFGALVPEAYGGAGLSTRLFARMVEAIAYYDGA
LALTVASHNSLATGHILLAGSEAQKEAFLPKLASGEAL

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2d29A01
FEEGAEERQVLGPFREFLKAEVAPGAAERDRTGAFPWDLVRKLAEFGVFGALVPEAYGGAGLSTRLFARMVEAIAYYDGA
LALTVASHNSLATGHILLAGSEAQKEAFLPKLASGEAL

BLAST against CATH

[top]
Domain History Events (16)

Domain assigned by auto on 02 Nov 2006 14:31

Assigning to "1.10.540.10" based on similarity with "1ws9A01"

Flow stage update by auto on 02 Nov 2006 14:25

No in_process hits for Domain "2d29A01" ready to be processed

Update comment by auto on 02 Nov 2006 10:07

Domain "2d29A01" hits Domain "2cx9B01" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 06:12

Domain "2d29A01" hits Domain "2cx9D01" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 03:17

Domain "2d29A01" hits Domain "2cx9C01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 21:56

Domain "2d29A01" hits Domain "2cx9A01" (100% over 100%) which is currently in process