CATH Domain: 2cz2A02 XML data for domain: 2cz2A02

Molscript image for 2cz2A02
2cz2A02
PDB coordinates for domain 2cz2A02

PDB 2cz2, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.6
1.20.1050.10.6.1
1.20.1050.10.6.1.1
1.20.1050.10.6.1.1.1
1.20.1050.10.6.1.1.1.1

[top]
Segment boundaries for domain 2cz2A02

Chopping figure for domain 2cz2A02
DomainStart PDB ResidueStop PDB Residue
2cz2A01 8 85
2cz2A02 90 215

Structural Neighbourhood (20 entries)

There are 20 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 20 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2v6kA02 93.48 Maleylpyruvate isomeraseRalstonia sp. U2 1.20.1050.10 130 35 91 1.11 1.21
1e6bA02 89.06 Arabidopsis thalianaToxin catabolic processGlutathione S-transferase zeta-class 1 1.20.1050.10 111 40 87 2.01 2.29
3fr3B02 84.98 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismPlasmodium falciparum 1.20.1050.10 114 14 87 2.33 2.66
2pvqA02 84.69 Glutathione S-transferaseOchrobactrum anthropi 1.20.1050.10 104 20 79 2.46 3.09
2dsaA02 84.49 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 16 83 2.78 3.33
1eemA02 84.47 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase omega-1Metabolism of xenobiotics by cytochrome P450Homo sapiens 1.20.1050.10 115 17 89 2.65 2.97
1oe8A02 84.24 Schistosoma haematobiumGlutathione S-transferase class-mu 28 kDa isozyme 1.20.1050.10 124 16 91 2.65 2.91
2gsqA02 84.19 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 17 81 2.40 2.93
1dugA02 84.18 Fibrinogen gamma chainGlutathione S-transferase class-mu 26 kDa isozymeExternal side of plasma membraneFibrinogen complexEukaryotic cell surface binding 1.20.1050.10 105 15 82 2.35 2.84
1hqoA02 84.03 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 13 84 3.00 3.57
3f6dB02 83.75 Anopheles dirusGlutathione transferase GST1-4 1.20.1050.10 123 15 88 3.29 3.71
3h1nA02 83.64 Bordetella bronchisepticaProbable glutathione S-transferase 1.20.1050.10 115 13 78 2.25 2.86
1gnwA02 83.54 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 11 87 3.40 3.90
1gwcA02 83.46 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 18 85 3.33 3.88
1m0uA02 83.05 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase S1Metabolism of xenobiotics by cytochrome P450Glutathione peroxidase activity 1.20.1050.10 112 13 82 2.90 3.50
2vo4A02 82.17 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 22 87 4.01 4.56
1n2aA02 82.16 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12 1.20.1050.10 106 10 80 2.92 3.64
3cbuA02 81.84 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 13 89 3.86 4.32
1k0oB02 81.07 Membrane fractionChloride intracellular channel protein 1Soluble fractionChloride transportSignal transduction 1.20.1050.10 123 11 88 3.98 4.49
1aw9A02 80.02 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 13 90 4.05 4.49
[1]
Displaying entries 1 to 20 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2cz2A02
PQDPQKRAIVRISDLIASGIQPLQNLSVLKQVGQENQQWAQKVITSGFNALEKILQSTAGKYCVGDEVSADVCLVPQVAN
AERFKVDLSPYPTISHINKELLALEVFQVSHPRRQPDTPAELR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2cz2A02
PQDPQKRAIVRXISDLIASGIQPLQNLSVLKQVGQENQXQWAQKVITSGFNALEKILQSTAGKYCVGDEVSXADVCLVPQ
VANAERFKVDLSPYPTISHINKELLALEVFQVSHPRRQPDTPAELRT
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:30

Assigning to "1.20.1050.10" based on similarity with "2cz3B02" (NWSI: 97.6377952755905, NWO: 100, SPS: 96.19, SPO: 92, RMSD: 0.48)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "2cz2A02"

Flow stage update by auto on 28 Apr 2006 17:48

All required files are present for Domain "2cz2A02"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "2cz2A02"

Insertion by auto on 15 Mar 2006 02:00

Final ChopClose added based on similarity with "1fw1A" [LEE: 3, LME: 0, MR: 0, LG: 2, SS: 96.99, SI: 83.3333333333333, SO: 96.8609865470852]