CATH Domain: 2cxnA03

2cxnA03

PDB 2cxn, Chain A, Domain 3

CATH Code	Level Description	Links
1	Mainly Alpha
1.10	Orthogonal Bundle
1.10.1390	Phosphoglucose isomerase, C-terminal domain
1.10.1390.10		Gene3D
1.10.1390.10.1
1.10.1390.10.1.1
1.10.1390.10.1.1.1
1.10.1390.10.1.1.1.1
1.10.1390.10.1.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2cxnA03

Domain	Start PDB Residue	Stop PDB Residue
2cxnA01	1	99
2cxnA01	295	515
2cxnA02	100	294
2cxnA03	516	556

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.1390.10.1.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	2o2cA03	90.90	Glucose-6-phosphate isomerase, glycosomalTrypanosoma brucei brucei	1.10.1390.10	48	48	81	1.16	1.43
	2wu8A03	89.82	Amino sugar and nucleotide sugar metabolismMetabolic pathwaysStarch and sucrose metabolismPentose phosphate pathwayGlycolysis / Gluconeogenesis	1.10.1390.10	45	36	91	2.83	3.11

[top]
Domain ATOM Sequence

>pdb|2cxnA03
ELGKQLAKKIEPELEGSSAVTSHDSSTNGLISFIKQQRDTK

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2cxnA03
ELGKQLAKKIEPELEGSSAVTSHDSSTNGLISFIKQQRDTK

BLAST against CATH

[top]
Domain History Events (16)

Domain assigned by auto on 02 Nov 2006 14:30

Assigning to "1.10.1390.10" based on similarity with "2cxrB03"

Flow stage update by auto on 02 Nov 2006 14:25

No in_process hits for Domain "2cxnA03" ready to be processed

Update comment by auto on 02 Nov 2006 10:06

Domain "2cxnA03" hits Domain "2cxrB03" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 06:12

Domain "2cxnA03" hits Domain "2cxuA03" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 03:17

Domain "2cxnA03" hits Domain "2cxuB03" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 21:56

Domain "2cxnA03" hits Domain "2cxrA03" (100% over 100%) which is currently in process