CATH Domain: 2cxnA02 XML data for domain: 2cxnA02

Molscript image for 2cxnA02
2cxnA02
PDB coordinates for domain 2cxnA02

PDB 2cxn, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.10490 Glucose-6-phosphate isomerase like protein; domain 1 Gene3D
3.40.50.10490.2
3.40.50.10490.2.1
3.40.50.10490.2.1.1
3.40.50.10490.2.1.1.1
3.40.50.10490.2.1.1.1.1

Segment boundaries for domain 2cxnA02

Chopping figure for domain 2cxnA02
DomainStart PDB ResidueStop PDB Residue
2cxnA01 1 99
2cxnA01 295 515
2cxnA02 100 294
2cxnA03 516 556

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.40.50.10490.2.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2o2cA02 88.54 Glucose-6-phosphate isomerase, glycosomalTrypanosoma brucei brucei 3.40.50.10490 134 61 66 1.01 1.53
2q8nA02 85.66 Thermotoga maritimaAmino sugar and nucleotide sugar metabolismGlucose-6-phosphate isomeraseGlucose-6-phosphate isomerase [EC:5.3.1.9]Metabolic pathways 3.40.50.10490 162 26 75 2.27 2.99
3ff1B02 85.24 Amino sugar and nucleotide sugar metabolismMetabolic pathwaysStarch and sucrose metabolismPentose phosphate pathwayGlycolysis / Gluconeogenesis 3.40.50.10490 179 22 86 2.63 3.05
3i0zA01 75.98 Sugar isomerase domain protein AgaSTagatose-6-phosphate ketose/aldose isomerase [EC:5.-.-.-]Streptococcus pneumoniae 3.40.50.10490 201 9 79 3.75 4.74
2o2cC01 64.51 Glucose-6-phosphate isomerase, glycosomalTrypanosoma brucei brucei 3.40.50.10490 379 23 17 0.47 2.70
Displaying entries 1 to 5 (page 1 of 1)


Domain ATOM Sequence

>pdb|2cxnA02
HVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGSDLGPLMVTEALKPYSKGGP
RVWFVSNIDGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDPSAVAKHFVALSTNTAKVKEFGID
PQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDHFE    

Domain COMBS Sequence

>pdb|2cxnA02
HVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGSDLGPLMVTEALKPYSKGGP
RVWFVSNIDGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDPSAVAKHFVALSTNTAKVKEFGID
PQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDHFE    

Domain History Events (16)

Domain assigned by auto on 02 Nov 2006 14:30

Assigning to "3.40.50.10490" based on similarity with "2cxrA02"

Flow stage update by auto on 02 Nov 2006 14:25

No in_process hits for Domain "2cxnA02" ready to be processed

Update comment by auto on 02 Nov 2006 10:06

Domain "2cxnA02" hits Domain "2cxrB02" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 06:12

Domain "2cxnA02" hits Domain "2cxrA02" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 03:17

Domain "2cxnA02" hits Domain "2cxuA02" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 21:56

Domain "2cxnA02" hits Domain "2cxuB02" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 18:04

Domain "2cxnA02" hits Domain "2cvpB02" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 14:28

Domain "2cxnA02" hits Domain "2cvpA02" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "2cxnA02" hits Domain "2cvpA02" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2cxnA02" hits Domain "2cvpA02" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "2cxnA02" hits Domain "2cvpA02" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2006 05:27

Domain "2cxnA02" hits Domain "2cvpA02" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2006 05:27

NW result present for Domain "2cxnA02"

Flow stage update by auto on 17 Oct 2006 17:34

All required files are present for Domain "2cxnA02"

Flow stage update by auto on 16 Oct 2006 16:33

Beginning processing for Domain "2cxnA02"

Insertion by auto on 16 Oct 2006 16:21

Final ChopClose added based on similarity with "2cvpA"