CATH Domain: 2cxnA01 XML data for domain: 2cxnA01

Molscript image for 2cxnA01
2cxnA01
PDB coordinates for domain 2cxnA01

PDB 2cxn, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.10490 Glucose-6-phosphate isomerase like protein; domain 1 Gene3D
3.40.50.10490.20
3.40.50.10490.20.1
3.40.50.10490.20.1.1
3.40.50.10490.20.1.1.1
3.40.50.10490.20.1.1.1.1

Segment boundaries for domain 2cxnA01

Chopping figure for domain 2cxnA01
DomainStart PDB ResidueStop PDB Residue
2cxnA01 1 99
2cxnA01 295 515
2cxnA02 100 294
2cxnA03 516 556

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.50.10490.20.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2o2cC01 90.85 Glucose-6-phosphate isomerase, glycosomalTrypanosoma brucei brucei 3.40.50.10490 379 49 81 0.86 1.06
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|2cxnA01
MAALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNNFSLNLNTNHGHILVDYSKNLVSKEVMQMLVELAKSRGVEAA
RDNMFSGSKINYTEDRAVLQLLSGAHWMDQHFLKTPLEKNAPVLLALLGIWYINCYGCETHALLPYDQYMHRFAAYFQQG
DMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEA
LMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFTKLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGV    

Domain COMBS Sequence

>pdb|2cxnA01
MAALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNNFSLNLNTNHGHILVDYSKNLVSKEVMQMLVELAKSRGVEAA
RDNMFSGSKINYTEDRAVLQLLSGAHWMDQHFLKTPLEKNAPVLLALLGIWYINCYGCETHALLPYDQYMHRFAAYFQQG
DMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEA
LMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFTKLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGV    

Domain History Events (17)

Domain assigned by auto on 02 Nov 2006 18:17

Assigning to "3.40.50.10490" based on similarity with "2cxrA01"

Flow stage update by auto on 02 Nov 2006 18:14

No in_process hits for Domain "2cxnA01" ready to be processed

Update comment by auto on 02 Nov 2006 14:25

Domain "2cxnA01" hits Domain "2cxrB01" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 10:06

Domain "2cxnA01" hits Domain "2cxrA01" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 06:12

Domain "2cxnA01" hits Domain "2cxoB01" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 03:17

Domain "2cxnA01" hits Domain "2cxuA01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 21:56

Domain "2cxnA01" hits Domain "2cxuB01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 18:04

Domain "2cxnA01" hits Domain "2cvpB01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 14:28

Domain "2cxnA01" hits Domain "2cvpA01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "2cxnA01" hits Domain "2cvpA01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2cxnA01" hits Domain "2cvpA01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "2cxnA01" hits Domain "2cvpA01" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2006 05:27

Domain "2cxnA01" hits Domain "2cvpA01" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2006 05:27

NW result present for Domain "2cxnA01"

Flow stage update by auto on 17 Oct 2006 17:34

All required files are present for Domain "2cxnA01"

Flow stage update by auto on 16 Oct 2006 16:33

Beginning processing for Domain "2cxnA01"

Insertion by auto on 16 Oct 2006 16:21

Final ChopClose added based on similarity with "2cvpA"