CATH Domain: 2cwdC00 XML data for domain: 2cwdC00

Molscript image for 2cwdC00
2cwdC00
PDB coordinates for domain 2cwdC00

PDB 2cwd, Chain C, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.270 Gene3D
3.40.50.270.3
3.40.50.270.3.1
3.40.50.270.3.1.1
3.40.50.270.3.1.1.1
3.40.50.270.3.1.1.1.1

[top]
Segment boundaries for domain 2cwdC00

Chopping figure for domain 2cwdC00
DomainStart PDB ResidueStop PDB Residue
2cwdC00 4 151

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.40.50.270.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2gi4A00 81.28 Campylobacter jejuniProtein-tyrosine phosphatase [EC:3.1.3.48]Putative phosphotyrosine protein phosphatase 3.40.50.270 156 29 94 3.21 3.38
1vrvA00 77.13 Phosphotransferase system (PTS)Fructose and mannose metabolismPTS system, mannitol-specific IIC componentPTS system, mannitol-specific IIA component [EC:2.7.1.69]PTS system, mannitol-specific IIB component [EC:2.7.1.69] 3.40.50.10370 96 11 59 2.70 4.54
2hjsA01 76.48 Pseudomonas aeruginosaCysteine and methionine metabolismAspartate-semialdehyde dehydrogenase [EC:1.2.1.11]Glycine, serine and threonine metabolismUSG-1 protein homolog 3.40.50.720 148 8 79 3.94 4.98
3cwcB01 76.45 Glycerate kinase [EC:2.7.1.31]Glycerolipid metabolismSalmonella enterica subsp. enterica serovar TyphimuriumPutative glycerate kinase 2Glycine, serine and threonine metabolism 3.40.50.10350 137 5 75 3.70 4.93
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2cwdC00
PVRVLFVCLGNICRSPMAEGIFRKLLKERGLEDRFEVDSAGTGAWHVGEPMDPRARRVLEEEGAYFPHVARRLTREDVLA
YDHILVMDRENLEEVLRRFPEARGKVRLVLEELGGGEVQDPYYGDLEDFREVYWTLEAALQAFLDRHG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2cwdC00
MDRPVRVLFVCLGNICRSPMAEGIFRKLLKERGLEDRFEVDSAGTGAWHVGEPMDPRARRVLEEEGAYFPHVARRLTRED
VLAYDHILVMDRENLEEVLRRFPEARGKVRLVLEELGGGEVQDPYYGDLEDFREVYWTLEAALQAFLDRHGSPSPAAEGR
A
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 02 Dec 2006 09:21

Assigning to "3.40.50.270" based on similarity with "2cwdA00"

Flow stage update by auto on 02 Dec 2006 09:20

No in_process hits for Domain "2cwdC00" ready to be processed

Update comment by auto on 02 Dec 2006 05:22

Domain "2cwdC00" hits Domain "2cwdD00" (100% over 100%) which is currently in process

Flow stage update by auto on 02 Dec 2006 05:20

Domain "2cwdC00" hits Domain "2cwdD00" (100% over 100%) which is currently in process

Flow stage update by auto on 02 Dec 2006 05:20

NW result present for Domain "2cwdC00"

Flow stage update by auto on 29 Nov 2006 13:24

All required files are present for Domain "2cwdC00"

Flow stage update by auto on 28 Nov 2006 18:21

Beginning processing for Domain "2cwdC00"

Insertion by auto on 28 Nov 2006 17:53

Final ChopClose added based on similarity with "2cwdA"