CATH Domain: 2cvzA02

2cvzA02

PDB 2cvz, Chain A, Domain 2

CATH Code	Level Description	Links
1	Mainly Alpha
1.10	Orthogonal Bundle
1.10.1040	N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2
1.10.1040.10	N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2	Gene3D
1.10.1040.10.6
1.10.1040.10.6.1
1.10.1040.10.6.1.1
1.10.1040.10.6.1.1.1
1.10.1040.10.6.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2cvzA02

Domain	Start PDB Residue	Stop PDB Residue
2cvzA01	2	157
2cvzA02	158	289

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.

[top]
Domain ATOM Sequence

>pdb|2cvzA02
VGAGHAVKAINNALLAVNLWAAGEGLLALVKQGVSAEKALEVINASSGRSNATENLIPQRVLTRAFPKTFALGLLVKDLG
IAGVLDGEKAPSPLLRLAREVYEAKRELGPDADHVEALRLLERWGGVEIR

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2cvzA02
VGAGHAVKAINNALLAVNLWAAGEGLLALVKQGVSAEKALEVINASSGRSNATENLIPQRVLTRAFPKTFALGLLVKDLG
IAXGVLDGEKAPSPLLRLAREVYEXAKRELGPDADHVEALRLLERWGGVEIR

BLAST against CATH

[top]
Domain History Events (23)

Domain assigned by auto on 20 Nov 2008 18:58

Assigning to "1.10.1040.10" based on similarity with "1j3vA02"

Flow stage update by auto on 20 Nov 2008 18:49

No in_process hits for Domain "2cvzA02" ready to be processed

Update comment by auto on 20 Nov 2008 18:22

Domain "2cvzA02" hits Domain "2cvzB02" (98.4848484848485% over 100%) which is currently in process

Update comment by auto on 20 Nov 2008 17:58

Domain "2cvzA02" hits Domain "2cvzC02" (98.4848484848485% over 100%) which is currently in process

Update comment by auto on 20 Nov 2008 17:33

Domain "2cvzA02" hits Domain "2cvzD02" (98.4848484848485% over 100%) which is currently in process

Update comment by auto on 20 Nov 2008 17:06

Domain "2cvzA02" hits Domain "1wp4C02" (98.4848484848485% over 100%) which is currently in process

Update comment by auto on 20 Nov 2008 16:41

Domain "2cvzA02" hits Domain "1wp4B02" (98.4848484848485% over 100%) which is currently in process

Update comment by auto on 20 Nov 2008 16:13

Domain "2cvzA02" hits Domain "1wp4D02" (98.4848484848485% over 100%) which is currently in process

Update comment by auto on 20 Nov 2008 15:48

Domain "2cvzA02" hits Domain "1wp4A02" (98.4848484848485% over 100%) which is currently in process

Update comment by auto on 20 Nov 2008 15:23

Domain "2cvzA02" hits Domain "1j3vD02" (98.4848484848485% over 100%) which is currently in process

Update comment by auto on 20 Nov 2008 14:58

Domain "2cvzA02" hits Domain "1j3vC02" (98.4848484848485% over 100%) which is currently in process