CATH Domain: 2cvdA02

2cvdA02

PDB 2cvd, Chain A, Domain 2

CATH Code	Level Description	Links
1	Mainly Alpha
1.20	Up-down Bundle
1.20.1050	Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10		Gene3D
1.20.1050.10.5
1.20.1050.10.5.1
1.20.1050.10.5.1.1
1.20.1050.10.5.1.1.1
1.20.1050.10.5.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2cvdA02

Domain	Start PDB Residue	Stop PDB Residue
2cvdA01	2	75
2cvdA01	184	199
2cvdA02	76	183

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (22 entries)

There are 22 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.5.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
1dugA02	90.09	Fibrinogen gamma chainGlutathione S-transferase class-mu 26 kDa isozymeExternal side of plasma membraneFibrinogen complexEukaryotic cell surface binding	1.20.1050.10	105	21	94	1.78	1.88
2gsqA02	90.06	Ommastrephes sloaniGlutathione S-transferase	1.20.1050.10	108	25	94	1.94	2.05
3fr3B02	88.98	Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismPlasmodium falciparum	1.20.1050.10	114	16	85	2.43	2.83
1m0uA02	88.58	Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase S1Metabolism of xenobiotics by cytochrome P450Glutathione peroxidase activity	1.20.1050.10	112	26	96	2.30	2.39
3h1nA02	87.65	Bordetella bronchisepticaProbable glutathione S-transferase	1.20.1050.10	115	19	87	1.72	1.96
2dsaA02	87.39	Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400	1.20.1050.10	106	13	97	3.32	3.41
1n2aA02	86.89	Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12	1.20.1050.10	106	11	93	2.53	2.71
2pvqA02	86.70	Glutathione S-transferaseOchrobactrum anthropi	1.20.1050.10	104	14	91	2.76	3.01
1oe8A02	86.04	Schistosoma haematobiumGlutathione S-transferase class-mu 28 kDa isozyme	1.20.1050.10	124	20	86	2.51	2.91
1e6bA02	84.18	Arabidopsis thalianaToxin catabolic processGlutathione S-transferase zeta-class 1	1.20.1050.10	111	6	81	3.73	4.60
1eemA02	84.06	Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase omega-1Metabolism of xenobiotics by cytochrome P450Homo sapiens	1.20.1050.10	115	12	89	3.54	3.95
3f6dB02	83.88	Anopheles dirusGlutathione transferase GST1-4	1.20.1050.10	123	13	78	2.39	3.06
1hqoA02	83.56	Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation	1.20.1050.10	126	14	84	3.19	3.79
2v6kA02	83.07	Maleylpyruvate isomeraseRalstonia sp. U2	1.20.1050.10	130	12	80	2.69	3.36
1aw9A02	82.42	Glutathione transferase III(A)Zea mays	1.20.1050.10	121	10	85	4.09	4.76
1v2aA02	82.40	Anopheles dirusGlutathione transferase gst1-6	1.20.1050.10	132	12	81	3.86	4.76
2cz2A02	81.77	Tyrosine metabolismGlutathione transferase activityGlutathione metabolismMetabolic pathwaysGlutathione S-transferase [EC:2.5.1.18]	1.20.1050.10	122	16	80	2.79	3.47
2vo4A02	81.35	2,4-D inducible glutathione S-transferaseGlycine max	1.20.1050.10	132	9	71	3.21	4.51
1gwcA02	81.25	Aegilops tauschiiGlutathione S-transferase 1	1.20.1050.10	141	15	72	2.66	3.68
1gnwA02	80.79	Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process	1.20.1050.10	125	11	81	3.69	4.52
2c3nA02	79.82	Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism	1.20.1050.10	160	16	66	3.33	4.98
1k0oB02	78.63	Membrane fractionChloride intracellular channel protein 1Soluble fractionChloride transportSignal transduction	1.20.1050.10	123	12	74	3.49	4.67

[top]
Domain ATOM Sequence

>pdb|2cvdA02
DLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEI
CSTTLLVFKPDLLDNHPRLVTLRKKVQA

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2cvdA02
DLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEI
CSTTLLVFKPDLLDNHPRLVTLRKKVQA

BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 01 Nov 2006 22:07

Assigning to "1.20.1050.10" based on similarity with "2cvdB02"

Flow stage update by auto on 01 Nov 2006 21:56

No in_process hits for Domain "2cvdA02" ready to be processed