CATH Domain: 2cnrA00 XML data for domain: 2cnrA00

Molscript image for 2cnrA00
2cnrA00
PDB coordinates for domain 2cnrA00

PDB 2cnr, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1200 Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A
1.10.1200.10 Gene3D
1.10.1200.10.6
1.10.1200.10.6.1
1.10.1200.10.6.1.1
1.10.1200.10.6.1.1.1
1.10.1200.10.6.1.1.1.1

[top]
Segment boundaries for domain 2cnrA00

Chopping figure for domain 2cnrA00
DomainStart PDB ResidueStop PDB Residue
2cnrA00 1 82

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.1200.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2jq4A00 78.94 Agrobacterium tumefaciens str. C58Acyl carrier protein, putative 1.10.1200.10 83 15 89 3.26 3.66
1klpA00 77.00 Meromycolate extension acyl carrier proteinAcyl carrier proteinMycobacterium tuberculosis 1.10.1200.10 115 39 67 3.33 4.91
2bl0B01 75.61 Physarum polycephalumMyosin regulatory light chain 1.10.238.10 68 8 73 3.14 4.29
1qx2A00 75.10 Protein S100-GBos taurus 1.10.238.10 75 8 75 3.37 4.46
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2cnrA00
MAATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDH
QA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2cnrA00
MAATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDH
QA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 23 Jul 2007 03:12

Assigning to "1.10.1200.10" based on similarity with "1t8kA00"

Flow stage update by auto on 23 Jul 2007 03:07

No in_process hits for Domain "2cnrA00" ready to be processed

Flow stage update by auto on 23 Jul 2007 03:07

NW result present for Domain "2cnrA00"

Flow stage update by auto on 14 Jul 2007 06:02

All required files are present for Domain "2cnrA00"

Flow stage update by auto on 13 Jul 2007 18:42

Beginning processing for Domain "2cnrA00"

Insertion by auto on 13 Jul 2007 08:09

Final ChopClose added based on similarity with "1t8kA"