CATH Domain: 2cnqA02 XML data for domain: 2cnqA02

Molscript image for 2cnqA02
2cnqA02
PDB coordinates for domain 2cnqA02

PDB 2cnq, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.470 D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.20 ATP-grasp fold, B domain Gene3D
3.30.470.20.2
3.30.470.20.2.1
3.30.470.20.2.1.1
3.30.470.20.2.1.1.1
3.30.470.20.2.1.1.1.1

Segment boundaries for domain 2cnqA02

Chopping figure for domain 2cnqA02
DomainStart PDB ResidueStop PDB Residue
2cnqA01 2 112
2cnqA02 113 258

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.470.20.2.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3kreA02 87.01 Phosphoribosylaminoimidazole-succinocarboxamide synthasePurine metabolismPhosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]Ehrlichia chaffeensis str. ArkansasMetabolic pathways 3.30.470.20 138 21 84 1.93 2.28
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|2cnqA02
KLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEHDENISPAQAAELVGEDLSRRVAELA
VKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSY    

Domain COMBS Sequence

>pdb|2cnqA02
KLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEQGEHDENISPAQAAELVGEDLSRRVA
ELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSY    

Domain History Events (11)

Domain assigned by auto on 01 Nov 2006 18:36

Assigning to "3.30.470.20" based on similarity with "1a48002"

Flow stage update by auto on 01 Nov 2006 18:05

No in_process hits for Domain "2cnqA02" ready to be processed

Update comment by auto on 01 Nov 2006 14:29

Domain "2cnqA02" hits Domain "2cnuA02" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:49

Domain "2cnqA02" hits Domain "2cnuA02" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2cnqA02" hits Domain "2cnuA02" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:10

Domain "2cnqA02" hits Domain "2cnuA02" (100% over 100%) which is currently in process

Flow stage update by auto on 19 Oct 2006 09:25

Domain "2cnqA02" hits Domain "2cnuA02" (100% over 100%) which is currently in process

Flow stage update by auto on 19 Oct 2006 09:25

NW result present for Domain "2cnqA02"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "2cnqA02"

Flow stage update by auto on 16 Oct 2006 05:45

Beginning processing for Domain "2cnqA02"

Insertion by auto on 16 Oct 2006 05:16

Final ChopClose added based on similarity with "1a480"