CATH Domain: 2cnqA01 XML data for domain: 2cnqA01

Molscript image for 2cnqA01
2cnqA01
PDB coordinates for domain 2cnqA01

PDB 2cnq, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.200 Phosphorylase Kinase; domain 1
3.30.200.20 Phosphorylase Kinase; domain 1 Gene3D
3.30.200.20.4
3.30.200.20.4.1
3.30.200.20.4.1.1
3.30.200.20.4.1.1.1
3.30.200.20.4.1.1.1.1

[top]
Segment boundaries for domain 2cnqA01

Chopping figure for domain 2cnqA01
DomainStart PDB ResidueStop PDB Residue
2cnqA01 2 112
2cnqA02 113 258

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.200.20.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3kreA01 83.11 Phosphoribosylaminoimidazole-succinocarboxamide synthasePurine metabolismPhosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]Ehrlichia chaffeensis str. ArkansasMetabolic pathways 3.30.200.20 94 22 67 1.82 2.69
1kutB01 81.22 Thermotoga maritimaPhosphoribosylaminoimidazole-succinocarboxamide synthasePurine metabolismPhosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]Metabolic pathways 3.30.200.20 88 14 63 2.29 3.63
1z57A01 77.15 Homo sapiensProtein serine/threonine kinase activityNon-membrane spanning protein tyrosine kinase activityDual specificity protein kinase CLK1Cell proliferation 3.30.200.20 94 4 69 2.97 4.28
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2cnqA01
SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAP
GKTIFDYLPAKLSEPKYKTQLEDRSLLVHKH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2cnqA01
XSITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIA
PGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKH
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 01 Nov 2006 18:36

Assigning to "3.30.200.20" based on similarity with "2cnuA01"

Flow stage update by auto on 01 Nov 2006 18:05

No in_process hits for Domain "2cnqA01" ready to be processed

Update comment by auto on 01 Nov 2006 14:29

Domain "2cnqA01" hits Domain "2cnuA01" (99.1071428571429% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:49

Domain "2cnqA01" hits Domain "2cnuA01" (99.1071428571429% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2cnqA01" hits Domain "2cnuA01" (99.1071428571429% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:10

Domain "2cnqA01" hits Domain "2cnuA01" (99.1071428571429% over 100%) which is currently in process

Flow stage update by auto on 19 Oct 2006 09:25

Domain "2cnqA01" hits Domain "2cnuA01" (99.1071428571429% over 100%) which is currently in process

Flow stage update by auto on 19 Oct 2006 09:25

NW result present for Domain "2cnqA01"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "2cnqA01"

Flow stage update by auto on 16 Oct 2006 05:45

Beginning processing for Domain "2cnqA01"

Insertion by auto on 16 Oct 2006 05:16

Final ChopClose added based on similarity with "1a480"