CATH Domain: 2ck3A01 XML data for domain: 2ck3A01

Molscript image for 2ck3A01
2ck3A01
PDB coordinates for domain 2ck3A01

PDB 2ck3, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.30 Elongation Factor Tu (Ef-tu); domain 3
2.40.30.20 Gene3D
2.40.30.20.1
2.40.30.20.1.1
2.40.30.20.1.1.1
2.40.30.20.1.1.1.1
2.40.30.20.1.1.1.1.1

Segment boundaries for domain 2ck3A01

Chopping figure for domain 2ck3A01
DomainStart PDB ResidueStop PDB Residue
2ck3A01 24 93
2ck3A02 94 379
2ck3A03 380 510

Structural Neighbourhood (19 entries)

There are 19 matching structural neighberhood comparisons for CATH ID 2.40.30.20.1.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 19 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2wssA01 91.90 F-type H+-transporting ATPase subunit alpha [EC:3.6.3.14]Huntington's diseaseParkinson's diseaseOxidative phosphorylationBos taurus 2.40.30.20 93 100 75 0.49 0.65
2ck3D01 90.08 ATP catabolic processParkinson's diseaseOxidative phosphorylationAlzheimer's diseaseMetabolic pathways 2.40.10.170 73 15 91 1.59 1.73
2fvgA02 85.09 Endoglucanase [EC:3.2.1.4]Thermotoga maritimaStarch and sucrose metabolismEndoglucanase 2.40.30.40 76 20 84 2.56 3.04
1y0yA02 83.84 Endoglucanase [EC:3.2.1.4]Starch and sucrose metabolismPyrococcus horikoshiiTetrahedral aminopeptidase 2.40.30.40 81 12 80 2.44 3.04
2ey4C00 83.74 Pyrococcus furiosusSmall nucleolar rnp gar1-like proteinRNA-binding protein 2.40.10.230 73 14 91 3.00 3.27
1yloA02 83.56 Shigella flexneriPutative uncharacterized protein 2.40.30.40 76 18 81 2.47 3.03
2greF02 83.41 Aminopeptidase [EC:3.4.11.-]Deblocking aminopeptidaseBacillus cereus ATCC 14579 2.40.30.40 75 17 80 2.55 3.19
3kl9A02 83.35 Glutamyl aminopeptidase [EC:3.4.11.7]Glutamyl aminopeptidaseStreptococcus pneumoniae R6 2.40.30.40 74 14 79 2.39 3.00
3isxA02 82.14 Endoglucanase [EC:3.2.1.4]Thermotoga maritimaStarch and sucrose metabolismEndoglucanase 2.40.30.40 84 11 76 2.47 3.24
1vhoA02 81.66 Endoglucanase [EC:3.2.1.4]Thermotoga maritimaStarch and sucrose metabolismEndoglucanase 2.40.30.40 76 14 78 3.68 4.66
3cpxA02 81.41 Aminopeptidase, M42 familyCytophaga hutchinsonii ATCC 33406 2.40.30.40 61 13 80 2.83 3.54
1pkyC03 80.60 Purine metabolismPyruvate metabolismMetabolic pathwaysGlycolysis / GluconeogenesisMembrane 2.40.33.10 68 11 75 2.31 3.05
1i8dA01 79.86 Riboflavin metabolismMetabolic pathwaysRiboflavin synthase activityRiboflavin synthase alpha chain [EC:2.5.1.9]Riboflavin synthase alpha chain 2.40.30.20 89 17 77 3.36 4.33
1vhkA01 79.37 Bacillus subtilisRibosomal RNA small subunit methyltransferase ERibosomal RNA small subunit methyltransferase E [EC:2.1.1.-] 2.40.240.20 71 5 78 3.78 4.79
1wb1A04 78.37 Methanococcus maripaludisMJ0495-like protein 2.40.10.190 79 11 83 3.99 4.78
1v5vA03 75.85 Pyrococcus horikoshiiProbable aminomethyltransferase 2.40.30.110 75 10 56 2.77 4.95
1i8dC02 75.46 Riboflavin metabolismMetabolic pathwaysRiboflavin synthase activityRiboflavin synthase alpha chain [EC:2.5.1.9]Riboflavin synthase alpha chain 2.40.30.20 88 5 70 3.10 4.40
3bmvA03 75.11 Cyclomaltodextrin glucanotransferaseThermoanaerobacterium thermosulfurigenes 2.60.40.10 80 12 78 3.72 4.72
2d9rA00 72.01 Porphyromonas gingivalisPutative uncharacterized protein 2.40.30.100 82 4 82 4.06 4.90
Displaying entries 1 to 19 (page 1 of 1)


Domain ATOM Sequence

>pdb|2ck3A01
DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGA    

Domain COMBS Sequence

>pdb|2ck3A01
DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGA    

Domain History Events (11)

Domain assigned by auto on 01 Nov 2006 18:34

Assigning to "2.40.30.20" based on similarity with "2f43A01"

Flow stage update by auto on 01 Nov 2006 18:05

No in_process hits for Domain "2ck3A01" ready to be processed

Update comment by auto on 01 Nov 2006 14:28

Domain "2ck3A01" hits Domain "2ck3B01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:49

Domain "2ck3A01" hits Domain "2ck3B01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2ck3A01" hits Domain "2ck3B01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:10

Domain "2ck3A01" hits Domain "2ck3B01" (100% over 100%) which is currently in process

Flow stage update by auto on 19 Oct 2006 09:25

Domain "2ck3A01" hits Domain "2ck3B01" (100% over 100%) which is currently in process

Flow stage update by auto on 19 Oct 2006 09:25

NW result present for Domain "2ck3A01"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "2ck3A01"

Flow stage update by auto on 16 Oct 2006 07:08

Beginning processing for Domain "2ck3A01"

Insertion by auto on 16 Oct 2006 06:46

Final ChopClose added based on similarity with "1bmfA"