CATH Domain: 2cjlA02 XML data for domain: 2cjlA02

Molscript image for 2cjlA02
2cjlA02
PDB coordinates for domain 2cjlA02

PDB 2cjl, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.20 Endochitinase; domain 2
3.30.20.10 Endochitinase, domain 2 Gene3D
3.30.20.10.1
3.30.20.10.1.4
3.30.20.10.1.4.1
3.30.20.10.1.4.1.1
3.30.20.10.1.4.1.1.1

Segment boundaries for domain 2cjlA02

Chopping figure for domain 2cjlA02
DomainStart PDB ResidueStop PDB Residue
2cjlA01 12 75
2cjlA01 137 215
2cjlA02 76 136

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|2cjlA02
VEQNTANYPHYCDASQPYGCPAGNDKYYGRGPVQLSWNFNYKAAGDALGIDLLNNPDLVQN    

Domain COMBS Sequence

>pdb|2cjlA02
VEQNTANYPHYCDASQPYGCPAGNDKYYGRGPVQLSWNFNYKAAGDALGIDLLNNPDLVQN    

Domain History Events (6)

Domain assigned by auto on 27 Apr 2009 06:51

Assigning to "3.30.20.10" based on similarity with "2dbtC02"

Flow stage update by auto on 27 Apr 2009 05:52

No in_process hits for Domain "2cjlA02" ready to be processed

Flow stage update by auto on 27 Apr 2009 05:52

NW result present for Domain "2cjlA02"

Flow stage update by auto on 25 Apr 2009 08:08

All required files are present for Domain "2cjlA02"

Flow stage update by auto on 24 Apr 2009 02:31

Beginning processing for Domain "2cjlA02"

Insertion by auto on 23 Apr 2009 20:34

Final ChopClose added based on similarity with "2dbtA"