CATH Domain: 2cf7A00 XML data for domain: 2cf7A00

Molscript image for 2cf7A00
2cf7A00
PDB coordinates for domain 2cf7A00

PDB 2cf7, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.5
1.20.1260.10.5.1
1.20.1260.10.5.1.1
1.20.1260.10.5.1.1.1
1.20.1260.10.5.1.1.1.1

[top]
Segment boundaries for domain 2cf7A00

Chopping figure for domain 2cf7A00
DomainStart PDB ResidueStop PDB Residue
2cf7A00 14 172

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jigA00 92.52 Bacillus anthracisStarvation-inducible DNA-binding proteinDNA protection during starvation protein 1 1.20.1260.10 146 32 93 2.67 2.85
2fjcB00 92.42 Treponema pallidumStarvation-inducible DNA-binding proteinAntigen TpF1 1.20.1260.10 156 30 96 4.25 4.39
3kwoA00 90.60 DNA protection during starvation proteinCampylobacter jejuniStarvation-inducible DNA-binding proteinProtein binding 1.20.1260.10 144 26 92 2.33 2.52
2yw6B00 89.54 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 24 96 3.45 3.59
2qqyA00 89.17 Bacillus anthracisBacterioferritinPutative uncharacterized protein 1.20.1260.10 133 15 85 3.23 3.79
1tjoB00 88.93 DNA protection during starvation proteinHalobacterium salinarum 1.20.1260.10 175 18 88 3.97 4.48
2ib0A01 87.36 Mycobacterium tuberculosisCONSERVED HYPOTHETICAL ALANINE RICH PROTEIN 1.20.1260.10 135 9 84 3.60 4.25
1jm0A00 71.90 1.20.5.420 48 12 30 1.24 4.03
2rklB00 71.15 Multivesicular bodyVacuolar protein sorting-associated protein VTA1Membrane fractionProtein bindingEndocytosis 1.20.5.420 50 10 32 1.16 3.62
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2cf7A00
ASFSPRPDSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLAEMSERLITLGGAPFSTLKEFSE
NSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEGDSVTNDIFNVAKASIEKHIWMLQAELGQAPKL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2cf7A00
GSPAEIASFSPRPSLADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLAEMSERLITLGGAP
FSTLKEFSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEGDSVTNDIFNVAKASIEKHIWMLQAELG
QAPKL
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 11 Dec 2006 01:24

Assigning to "1.20.1260.10" based on similarity with "2cf7D00"

Flow stage update by auto on 11 Dec 2006 01:24

No in_process hits for Domain "2cf7A00" ready to be processed

Update comment by auto on 10 Dec 2006 21:18

Domain "2cf7A00" hits Domain "2cf7L00" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Dec 2006 21:17

Domain "2cf7A00" hits Domain "2cf7L00" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Dec 2006 21:17

NW result present for Domain "2cf7A00"

Flow stage update by auto on 10 Dec 2006 13:17

All required files are present for Domain "2cf7A00"

Flow stage update by auto on 09 Dec 2006 13:21

Beginning processing for Domain "2cf7A00"

Insertion by auto on 09 Dec 2006 13:21

Final ChopClose added based on similarity with "2cf7B"