Domain assigned by auto on 28 Apr 2006 22:06
Assigning to "2.60.40.420" based on similarity with "1arn000" (NWSI: 100, NWO: 100, SPS: 97.78, SPO: 100, RMSD: 0.75)
There are 12 matching structural neighberhood comparisons for CATH ID 2.60.40.420.5.1.1.1.1 (SIMAX score < 5)
>pdb|2ccwA00 AQCEATVESNDAMQYNVKEIVVDKSCKQFTMHLKHVGKMAKVAMGHNLVLTKDADKQAVATDGMGAGLAQDYVKAGDTRV IAHTKVIGGGESDSVTFDVSKIAAGENYAYFCSFPGHWAMMKGTLKLGS
Assigning to "2.60.40.420" based on similarity with "1arn000" (NWSI: 100, NWO: 100, SPS: 97.78, SPO: 100, RMSD: 0.75)
NW result present for Domain "2ccwA00"
All required files are present for Domain "2ccwA00"
Beginning processing for Domain "2ccwA00"