CATH Domain: 2c92A00 XML data for domain: 2c92A00

Molscript image for 2c92A00
2c92A00
PDB coordinates for domain 2c92A00

PDB 2c92, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.960 Gene3D
3.40.50.960.2
3.40.50.960.2.1
3.40.50.960.2.1.1
3.40.50.960.2.1.1.1
3.40.50.960.2.1.1.1.1

[top]
Segment boundaries for domain 2c92A00

Chopping figure for domain 2c92A00
DomainStart PDB ResidueStop PDB Residue
2c92A00 14 160

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.40.50.960.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1kz1C00 91.59 Riboflavin metabolismCytoplasmRiboflavin synthase beta chain [EC:2.5.1.-]NucleusMetabolic pathways 3.40.50.960 151 31 93 1.21 1.30
1c41A00 90.63 Riboflavin metabolismRiboflavin synthase beta chain [EC:2.5.1.-]Magnaporthe griseaMetabolic pathways6,7-dimethyl-8-ribityllumazine synthase 3.40.50.960 165 36 89 1.57 1.76
2obxA00 88.24 Riboflavin metabolismRiboflavin synthase beta chain [EC:2.5.1.-]6,7-dimethyl-8-ribityllumazine synthase 1Mesorhizobium lotiMetabolic pathways 3.40.50.960 150 25 91 2.31 2.53
2q5cA01 80.20 Clostridium acetobutylicumNtrC family transcriptional regulator (PAS and AAA domains) 3.40.50.2300 97 17 65 2.52 3.82
2g2cA00 77.48 Putative molybdenum cofactor biosynthesis proteinCorynebacterium diphtheriae 3.40.980.10 138 7 73 3.64 4.95
3iwtA00 76.75 178aa long hypothetical molybdenum cofactor biosynthesis protein BSulfolobus tokodaiiMolybdenum cofactor biosynthesis protein B 3.40.980.10 159 8 75 3.61 4.78
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2c92A00
DASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAIEIPVVAQELARNHDAVVALGVVIRGQTPHFDYV
CDAVTQGLTRVSLDSSTPIANGVLTTNTEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2c92A00
MKGGAGVPDLPSLDASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAIEIPVVAQELARNHDAVVALG
VVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTNTEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS
BLAST against CATH

[top]
Domain History Events (28)

Domain assigned by auto on 15 Aug 2007 09:18

Assigning to "3.40.50.960" based on similarity with "2c9dB00"

Flow stage update by auto on 15 Aug 2007 09:17

No in_process hits for Domain "2c92A00" ready to be processed

Update comment by auto on 15 Aug 2007 09:13

Domain "2c92A00" hits Domain "2c9dE00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 09:09

Domain "2c92A00" hits Domain "2c9dC00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 09:06

Domain "2c92A00" hits Domain "2c92D00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 08:59

Domain "2c92A00" hits Domain "2c94B00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 08:47

Domain "2c92A00" hits Domain "2c94C00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 08:28

Domain "2c92A00" hits Domain "2c9dB00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 08:05

Domain "2c92A00" hits Domain "2c92B00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 07:41

Domain "2c92A00" hits Domain "2c9dI00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 07:12

Domain "2c92A00" hits Domain "2c92C00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 06:53

Domain "2c92A00" hits Domain "2c9bB00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 06:31

Domain "2c92A00" hits Domain "2c94E00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 06:05

Domain "2c92A00" hits Domain "2c97E00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 05:36

Domain "2c92A00" hits Domain "2c97C00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 05:05

Domain "2c92A00" hits Domain "2c97B00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 04:34

Domain "2c92A00" hits Domain "2c97D00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 03:59

Domain "2c92A00" hits Domain "2c97A00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 03:20

Domain "2c92A00" hits Domain "2c9dH00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 02:37

Domain "2c92A00" hits Domain "2f59D00" (36.9426751592357% over 93.75%) which is currently in process

Update comment by auto on 15 Aug 2007 01:33

Domain "2c92A00" hits Domain "2f59C00" (36.9426751592357% over 93.75%) which is currently in process

Update comment by auto on 15 Aug 2007 00:04

Domain "2c92A00" hits Domain "2f59E00" (36.9426751592357% over 93.75%) which is currently in process

Update comment by auto on 14 Aug 2007 22:49

Domain "2c92A00" hits Domain "2f59A00" (36.9426751592357% over 93.75%) which is currently in process

Flow stage update by auto on 22 Jul 2007 03:16

Domain "2c92A00" hits Domain "2c9bH00" (100% over 100%) which is currently in process

Flow stage update by auto on 22 Jul 2007 03:16

NW result present for Domain "2c92A00"

Flow stage update by auto on 16 Jul 2007 22:38

All required files are present for Domain "2c92A00"

Flow stage update by auto on 15 Jul 2007 22:37

Beginning processing for Domain "2c92A00"

Insertion by auto on 15 Jul 2007 22:10

Final ChopClose added based on similarity with "1w19A"