Domain assigned by auto on 28 Apr 2006 21:58
Assigning to "3.90.120.10" based on similarity with "10mhA02" (NWSI: 100, NWO: 100, SPS: 97.75, SPO: 100, RMSD: 0.44)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2c7pA01 | 1 | 186 |
| 2c7pA01 | 285 | 327 |
| 2c7pA02 | 187 | 284 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|2c7pA02 ELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSAYGGGIFAKTGGYL VNGKTRKLHPRECARVMG
Assigning to "3.90.120.10" based on similarity with "10mhA02" (NWSI: 100, NWO: 100, SPS: 97.75, SPO: 100, RMSD: 0.44)
NW result present for Domain "2c7pA02"
All required files are present for Domain "2c7pA02"
Beginning processing for Domain "2c7pA02"