Domain assigned by auto on 07 Dec 2006 05:31
Assigning to "3.40.50.300" based on similarity with "1aipA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2c78A01 | 9 | 213 |
| 2c78A02 | 216 | 307 |
| 2c78A03 | 311 | 404 |
There are 31 matching structural neighberhood comparisons for CATH ID 3.40.50.300.6.1.1.1.1 (SIMAX score < 5)
>pdb|2c78A01 KPHVNVGTIGHVDHGKTTLTAALTYVAAAENPNVEVKDYGDIDKAPEERARGITINTAHVEYETAKRHYSHVDCPGHADY IKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPELLDLVEMEVRDLLNQYEFPGDEV PVIRGSALLALEQMHRNPKTRRGENEWVDKIWELLDAIDEYIPTP
Assigning to "3.40.50.300" based on similarity with "1aipA01"
No in_process hits for Domain "2c78A01" ready to be processed
NW result present for Domain "2c78A01"
All required files are present for Domain "2c78A01"
Beginning processing for Domain "2c78A01"
Final ChopClose added based on similarity with "1exmA"