Domain assigned by auto on 28 Apr 2006 21:54
Assigning to "1.20.1050.10" based on similarity with "1hncC02" (NWSI: 100, NWO: 100, SPS: 95.38, SPO: 100, RMSD: 0.65)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2c4jA01 | 2 | 86 |
| 2c4jA01 | 192 | 218 |
| 2c4jA02 | 87 | 191 |
There are 26 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.4.1.1.1.1 (SIMAX score < 5)
>pdb|2c4jA02 CGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLER NQVFEPSCLDAFPNLKDFISRFEGL
Assigning to "1.20.1050.10" based on similarity with "1hncC02" (NWSI: 100, NWO: 100, SPS: 95.38, SPO: 100, RMSD: 0.65)
NW result present for Domain "2c4jA02"
All required files are present for Domain "2c4jA02"
Beginning processing for Domain "2c4jA02"