CATH Domain: 2c4jA02 XML data for domain: 2c4jA02

Molscript image for 2c4jA02
2c4jA02
PDB coordinates for domain 2c4jA02

PDB 2c4j, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.4
1.20.1050.10.4.1
1.20.1050.10.4.1.1
1.20.1050.10.4.1.1.1
1.20.1050.10.4.1.1.1.1

[top]
Segment boundaries for domain 2c4jA02

Chopping figure for domain 2c4jA02
DomainStart PDB ResidueStop PDB Residue
2c4jA01 2 86
2c4jA01 192 218
2c4jA02 87 191

Structural Neighbourhood (26 entries)

There are 26 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 26 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1dugA02 92.42 Fibrinogen gamma chainGlutathione S-transferase class-mu 26 kDa isozymeExternal side of plasma membraneFibrinogen complexEukaryotic cell surface binding 1.20.1050.10 105 38 100 1.52 1.52
2cvdA02 89.44 CytoplasmProstaglandin-H2 D-isomerase [EC:5.3.99.2]Arachidonic acid metabolismProstaglandin-D synthase activityHematopoietic prostaglandin D synthase 1.20.1050.10 108 22 93 1.70 1.82
2dsaA02 88.92 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 20 98 2.31 2.35
1n2aA02 88.74 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12 1.20.1050.10 106 16 98 1.98 2.02
3fr3B02 88.60 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismPlasmodium falciparum 1.20.1050.10 114 22 85 1.62 1.88
2pvqA02 88.30 Glutathione S-transferaseOchrobactrum anthropi 1.20.1050.10 104 15 97 2.05 2.11
3h1nA02 87.54 Bordetella bronchisepticaProbable glutathione S-transferase 1.20.1050.10 115 13 86 1.73 1.99
2gsqA02 87.22 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 19 94 2.09 2.21
1m0uA02 87.00 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase S1Metabolism of xenobiotics by cytochrome P450Glutathione peroxidase activity 1.20.1050.10 112 20 92 2.31 2.49
1oe8A02 85.81 Schistosoma haematobiumGlutathione S-transferase class-mu 28 kDa isozyme 1.20.1050.10 124 20 84 1.94 2.29
1aw9A02 85.00 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 12 85 3.15 3.70
3f6dB02 84.67 Anopheles dirusGlutathione transferase GST1-4 1.20.1050.10 123 13 78 1.90 2.43
1e6bA02 83.86 Arabidopsis thalianaToxin catabolic processGlutathione S-transferase zeta-class 1 1.20.1050.10 111 9 82 3.42 4.13
1v2aA02 82.99 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 13 78 2.47 3.13
2cz2A02 82.66 Tyrosine metabolismGlutathione transferase activityGlutathione metabolismMetabolic pathwaysGlutathione S-transferase [EC:2.5.1.18] 1.20.1050.10 122 7 82 2.22 2.68
1hqoA02 82.12 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 11 80 2.68 3.31
1gnwA02 82.02 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 12 83 3.21 3.86
3bbyA02 81.51 Uncharacterized GST-like protein yfcFEscherichia coli K-12 1.20.1050.10 110 13 85 4.11 4.81
3cbuA02 81.46 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 12 77 2.55 3.30
1gwcA02 81.44 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 20 73 2.24 3.04
1k0oB02 81.40 Membrane fractionChloride intracellular channel protein 1Soluble fractionChloride transportSignal transduction 1.20.1050.10 123 14 75 2.72 3.60
1nhyA02 81.06 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 12 74 2.55 3.41
2v6kA02 80.65 Maleylpyruvate isomeraseRalstonia sp. U2 1.20.1050.10 130 13 79 2.71 3.42
2vo4A02 79.83 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 15 73 3.43 4.67
2c3nA02 79.34 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 16 65 3.05 4.65
1pd3A00 75.12 Nuclear export proteinInfluenza A virus (A/Puerto Rico/8/1934(H1N1)) 1.10.287.230 54 11 49 2.36 4.77
[1]
Displaying entries 1 to 26 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2c4jA02
CGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLER
NQVFEPSCLDAFPNLKDFISRFEGL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2c4jA02
CGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLER
NQVFEPSCLDAFPNLKDFISRFEGL
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:54

Assigning to "1.20.1050.10" based on similarity with "1hncC02" (NWSI: 100, NWO: 100, SPS: 95.38, SPO: 100, RMSD: 0.65)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "2c4jA02"

Flow stage update by auto on 28 Apr 2006 17:49

All required files are present for Domain "2c4jA02"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "2c4jA02"

Insertion by auto on 10 Mar 2006 20:13

Final ChopClose added based on similarity with "2c4jC" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.06, SI: 100, SO: 100]