CATH Domain: 2c4jA02 XML data for domain: 2c4jA02

Molscript image for 2c4jA02
2c4jA02
PDB coordinates for domain 2c4jA02

PDB 2c4j, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.3
1.20.1050.10.3.1
1.20.1050.10.3.1.1
1.20.1050.10.3.1.1.1
1.20.1050.10.3.1.1.1.1

[top]
Segment boundaries for domain 2c4jA02

Chopping figure for domain 2c4jA02
DomainStart PDB ResidueStop PDB Residue
2c4jA01 2 86
2c4jA01 192 218
2c4jA02 87 191

Structural Neighbourhood (24 entries)

There are 24 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 24 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1dugA02 92.42 Fibrinogen gamma chain precursorFibrinogen complexHomo sapiens 1.20.1050.10 105 38 100 1.52 1.52
2cvdA02 89.44 CytoplasmGlutathione-requiring prostaglandin D synthaseArachidonic acid metabolismWhole blood and lymphProstaglandin-D synthase activity 1.20.1050.10 108 22 93 1.70 1.82
2dsaA02 88.92 Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 20 98 2.31 2.35
1n2aA02 88.74 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferaseGlutathione S-transferaseEscherichia coli K12 1.20.1050.10 106 16 98 1.98 2.02
2pvqA02 88.30 Glutathione S-transferaseOchrobactrum anthropi 1.20.1050.10 104 15 97 2.05 2.11
1oktA02 87.35 Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione S-transferaseGlutathione metabolismPlasmodium falciparum 1.20.1050.10 126 22 80 1.90 2.35
2gsqA02 87.22 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 19 94 2.09 2.21
1m0uA02 87.00 Glutathione S-transferase S1Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione peroxidase activityGlutathione transferase activity 1.20.1050.10 112 20 92 2.31 2.49
1oe8A02 85.80 Schistosoma haematobiumGlutathione S-transferase class-mu 28 kDa isozyme 1.20.1050.10 124 20 84 1.94 2.29
1aw9A02 85.00 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 12 85 3.15 3.70
1jlvA02 83.84 Anopheles dirusGlutathione transferase GST1-3 1.20.1050.10 130 14 80 2.65 3.31
1v2aA02 82.99 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 13 78 2.47 3.13
2cz2A02 82.66 MitochondrionTyrosine metabolismMaleylacetoacetate isomeraseStyrene degradationCytoplasm 1.20.1050.10 122 7 82 2.22 2.68
1hqoA02 82.12 Regulation of nitrogen metabolismTelomere maintenanceSoluble fractionRegulator of transcription factorCytosol 1.20.1050.10 126 11 80 2.68 3.31
1gnwA02 82.02 Glutathione transferase activityMicrosomePlasma membraneToxin catabolic processMetabolism of phenylpropanoids 1.20.1050.10 125 12 83 3.21 3.86
3bbyA02 81.51 Escherichia coli K12Uncharacterized GST-like protein yfcF 1.20.1050.10 110 13 85 4.11 4.81
3cbuA02 81.46 Ralstonia eutropha JMP134Probable gst-related protein 1.20.1050.10 132 12 77 2.55 3.30
1gwcA02 81.44 Aegilops tauschiiGlutathione S-transferase TSI-1 1.20.1050.10 141 20 73 2.24 3.04
1k0oB02 81.40 Anion transportSoluble fractionProtein bindingSignal transductionBrush border 1.20.1050.10 123 14 75 2.72 3.60
1nhyA02 81.06 Calcium ion bindingPositive regulation of transcription from RNA polymerase II promoterTranslational controlElongation factor 1-gamma 1Nucleus 1.20.1050.10 139 12 74 2.55 3.41
2v6kA02 80.65 Maleylpyruvate isomeraseRalstonia sp. U2 1.20.1050.10 130 13 79 2.71 3.42
1g7oA02 79.95 Glutaredoxin-2Glutaredoxin 2Escherichia coli K12 1.20.1050.10 126 8 67 2.25 3.34
2vo4A02 79.83 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 15 73 3.43 4.67
2c3nA02 79.32 Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione S-transferase theta-1Homo sapiensGlutathione transferase activity 1.20.1050.10 160 16 65 3.05 4.65
[1]
Displaying entries 1 to 24 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2c4jA02
CGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLER
NQVFEPSCLDAFPNLKDFISRFEGL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2c4jA02
CGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLER
NQVFEPSCLDAFPNLKDFISRFEGL
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:54

Assigning to "1.20.1050.10" based on similarity with "1hncC02" (NWSI: 100, NWO: 100, SPS: 95.38, SPO: 100, RMSD: 0.65)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "2c4jA02"

Flow stage update by auto on 28 Apr 2006 17:49

All required files are present for Domain "2c4jA02"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "2c4jA02"

Insertion by auto on 10 Mar 2006 20:13

Final ChopClose added based on similarity with "2c4jC" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.06, SI: 100, SO: 100]