CATH Domain: 2c45A00 XML data for domain: 2c45A00

Molscript image for 2c45A00
2c45A00
PDB coordinates for domain 2c45A00

PDB 2c45, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.40 Barwin-like endoglucanases
2.40.40.20 Gene3D
2.40.40.20.12
2.40.40.20.12.1
2.40.40.20.12.1.1
2.40.40.20.12.1.1.1
2.40.40.20.12.1.1.1.1

[top]
Segment boundaries for domain 2c45A00

Chopping figure for domain 2c45A00
DomainStart PDB ResidueStop PDB Residue
2c45A00 1 114

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 2.40.40.20.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1e32A01 80.45 Mus musculusPolyubiquitin bindingProtein complexAggresome assemblyTransitional endoplasmic reticulum ATPase 2.40.40.20 87 17 74 3.26 4.39
1cz4A01 79.00 VCP-like ATPaseTransitional endoplasmic reticulum ATPaseThermoplasma acidophilum 2.40.40.20 92 17 74 2.87 3.86
1cr5A01 77.42 Mating projection tipVesicular-fusion protein SEC18Vacuole fusion, non-autophagicATPase activityER to Golgi vesicle-mediated transport 2.40.40.20 77 12 62 2.85 4.54
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2c45A00
MLRTMLKSKIHRATVTCADLHYVGSVTIDADLMDAADLLEGEQVTIVDIDNGARLVTYAITGERGSGVIGINGAAAHLVH
PGDLVILIAYATMDDARARTYQPRIVFVDAYNKP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2c45A00
MLRTMLKSKIHRATVTCADLHYVGSVTIDADLMDAADLLEGEQVTIVDIDNGARLVTYAITGERGSGVIGINGAAAHLVH
PGDLVILIAYATMDDARARTYQPRIVFVDAYNKP
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 15 Aug 2007 02:47

Assigning to "2.40.40.20" based on similarity with "2c45F00"

Flow stage update by auto on 15 Aug 2007 02:37

No in_process hits for Domain "2c45A00" ready to be processed

Update comment by auto on 15 Aug 2007 01:31

Domain "2c45A00" hits Domain "2c45D00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 00:03

Domain "2c45A00" hits Domain "2c45F00" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:48

Domain "2c45A00" hits Domain "2c45E00" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Jul 2007 23:04

Domain "2c45A00" hits Domain "2c45H00" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Jul 2007 23:04

NW result present for Domain "2c45A00"

Flow stage update by auto on 16 Jul 2007 22:37

All required files are present for Domain "2c45A00"

Flow stage update by auto on 14 Jul 2007 23:03

Beginning processing for Domain "2c45A00"

Insertion by auto on 14 Jul 2007 22:12

Final ChopClose added based on similarity with "2c45B"