Domain assigned by auto on 11 Jan 2007 07:42
Assigning to "3.40.920.10" based on similarity with "2pdaB03"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2c42A01 | 2 | 258 |
| 2c42A02 | 259 | 415 |
| 2c42A03 | 416 | 627 |
| 2c42A04 | 628 | 668 |
| 2c42A05 | 669 | 785 |
| 2c42A06 | 786 | 1170 |
| 2c42A07 | 1171 | 1232 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.920.10.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2raaA00 | 84.49 | 3.40.920.10 | 172 | 16 | 81 | 2.26 | 2.79 |
>pdb|2c42A03 GTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLVNRADYVACHNPAYV GIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLGGRINMIMQTAFFKLAGVLP FEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVTSLQEFKYPDSWKDAPA
Assigning to "3.40.920.10" based on similarity with "2pdaB03"
No in_process hits for Domain "2c42A03" ready to be processed
NW result present for Domain "2c42A03"
All required files are present for Domain "2c42A03"
Beginning processing for Domain "2c42A03"
Final ChopClose added based on similarity with "1b0pA"