CATH Domain: 2c10A01 XML data for domain: 2c10A01

Molscript image for 2c10A01
2c10A01
PDB coordinates for domain 2c10A01

PDB 2c10, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.40 Gene3D
3.10.450.40.9
3.10.450.40.9.2
3.10.450.40.9.2.1
3.10.450.40.9.2.1.1
3.10.450.40.9.2.1.1.1

[top]
Segment boundaries for domain 2c10A01

Chopping figure for domain 2c10A01
DomainStart PDB ResidueStop PDB Residue
2c10A01 41 165
2c10A02 166 297
2c10A03 322 728

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.10.450.40.9.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tu5A01 92.34 Tyrosine metabolismAmine metabolic processBos taurusCopper ion bindingPrimary-amine oxidase [EC:1.4.3.21] 3.10.450.40 108 42 96 1.69 1.75
1ksiA01 81.97 Pisum sativumPrimary amine oxidase 3.10.450.40 96 16 83 3.47 4.15
2gu3A02 73.85 Uncharacterized protein ypmBBacillus subtilis 3.10.450.40 63 4 57 2.64 4.61
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2c10A01
CQLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPPAREALAIVFFGRQPQP
NVSELVVGPLPHPSYMRDVTVERHGGPLP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2c10A01
GGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAA
ALAHLDRGSPPPAREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLP
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 01 Nov 2006 15:05

Assigning to "3.10.450.40" based on similarity with "1pu4A01"

Flow stage update by auto on 19 Oct 2006 01:41

No in_process hits for Domain "2c10A01" ready to be processed

Flow stage update by auto on 19 Oct 2006 01:40

NW result present for Domain "2c10A01"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "2c10A01"

Flow stage update by auto on 16 Oct 2006 07:53

Beginning processing for Domain "2c10A01"

Insertion by auto on 16 Oct 2006 07:28

Final ChopClose added based on similarity with "2c10B"